KEGG   Stackebrandtia nassauensis: Snas_0390Help
Entry
Snas_0390         CDS       T01194                                 

Definition
glycoside hydrolase family protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sna  Stackebrandtia nassauensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Snas_0390
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Snas_0390
Enzymes [BR:sna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Snas_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
394573..396084
Genome map
AA seq 503 aa AA seqDB search
MRLLRIPTACVILATALFIPGSAVADPSHAKAATPSTIPALGEWTAASGTYTYSESSRLV
VDPDHADELTDEAQTAAADLAALTGTEPEVVTGEPETGDVSLALGGGEPLGAEGYSLDVG
DTFAITANADAGAFYGTRTLLQLVKQDKQIPAGTATDVPKKPERGLMVDVGRKYMSVEWL
KKHIKDLSYAKLNYFHLHLSDTFGFRLESETHPEVTSEDHYTKAEIRELVDLAAKYHVTL
VPEIDVPGHVNAMLAQHPELQLEDQSGNKDPYFLDLSNPDAYTLVEDLIKEYLPLFPGPY
WHIGADEYVGDYGKYPQLEAYAKEHYGPDAVGKDAYYGFINWANEIVRDGGKTTRMWNDG
IKEGDGTIAPEANIVVDYWSTHGIDPQKLLDRGHTVMNASWTPTYYVLGGTDIDRRWLYE
DWNPDLFEKTLTIDDPKRNLGSKIHVWCDHPDAQTEDQITEGIRLPLRGLAQQTWGSPKL
VEGYDDFVAIDDAIGRAPGFSSL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcttcttcgcatccccaccgcctgcgtcatattggccacggcactgttcattccc
ggcagtgccgtggccgatccgtcccacgccaaagccgccaccccttcgacgatccccgca
ctcggcgaatggacggcggcgtccggcacctacacctactccgagtccagccgtctggtc
gtcgaccccgaccacgccgacgaactgaccgacgaagcccagaccgccgccgccgacctg
gcggcgctgaccggcaccgaacccgaggtcgtcaccggtgagcccgagaccggcgacgtg
tcgctggcgctgggtggcggcgaaccgctgggcgccgagggttacagcctcgacgtcggc
gacaccttcgccatcaccgccaacgccgacgcgggcgccttctacggcacccggacgctg
ttgcaactggtgaagcaggacaagcagatcccggccggtaccgccaccgacgtcccgaag
aaacccgaacgcggcctgatggtcgacgtcggccgcaagtacatgtccgtcgagtggctc
aagaagcacatcaaggacctgtcctacgccaaactcaactacttccacctgcacctgtcc
gacaccttcgggttccggctggagagcgagacccaccccgaggtgacctccgaggaccac
tacacgaaggccgagatccgcgagctggtcgacctggccgcgaagtaccacgtgacgctg
gtgcccgagatcgacgtgcccggtcacgtcaacgcgatgctcgcccagcacccggagttg
cagctggaagaccagtccggcaacaaggacccgtacttcctggatctgtccaatccggac
gcgtacacgctggtggaggacctgatcaaggagtacctgccgctgttcccgggaccgtac
tggcacatcggcgccgatgaatacgtcggcgactacgggaagtacccgcagctggaggcc
tacgccaaggagcactacggtcccgacgccgtcggcaaggacgcgtactacggcttcatc
aactgggccaacgagatcgtccgtgacggcggcaagaccactcgcatgtggaacgacggg
atcaaggagggcgacggcacgatagcgcccgaggcgaacatcgtcgtcgactactggtcc
acccacggcatcgatccgcagaagctgctggaccgtggccacacggtcatgaacgccagc
tggaccccgacgtactacgtgctgggcggcaccgacatcgaccggcgctggctgtacgag
gactggaacccggacctgttcgagaagacgctcaccatcgacgatccgaagcggaacctg
ggctccaagatccacgtgtggtgcgaccaccccgacgcccagaccgaggaccagatcacc
gagggcatccggctgccgctgcgcggcctggcccagcagacctggggctcgccgaaactc
gtcgaaggctatgacgacttcgtggccatagacgacgcgatcggccgggctccgggcttt
tcatctttgtag

DBGET integrated database retrieval system