KEGG   Stackebrandtia nassauensis: Snas_0445Help
Entry
Snas_0445         CDS       T01194                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Snas_0445
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Snas_0445
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Snas_0445
Enzymes [BR:sna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Snas_0445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
453058..454314
Genome map
AA seq 418 aa AA seqDB search
MTTTSVFTDSPAVGLVCRGCSATYPLAAQHACWECFGPLEVDYDATALAKVTREQIESGP
DNIWRYAALLPAGVDAATRVTLNPGMTPLVKADNLAAELGMKALWVKDDSANPTHSFKDR
VVSVALTAASQLGFDRFACASTGNLANSVAAHAARAGKPSIVFIPYDLEPGKVITTAVYG
GQLVAIEGSYDDVNRLCSELTETDEFENTAFVNVNVRPFYAEGSKTLGYEVAEQLGWRLP
RQVVIPMASGELLTKVDKAFTEMGEIGLVDPSEVKVFGAQSSGCNPIATALRAGTDEITP
VKPTGIAKSLNIGDPAAGPYAIESVRRTGGWMADVDDDEIREGIRLLARTTGVFAETAGG
VVVATLKKLLAEGRLDPEAETVIYNTGEGLKTLDAVTAGPTHQVKPSLKSVKEAGLLS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacctctgtattcaccgattcccccgccgtcggcctggtgtgccggggctgt
tccgccacctacccgctggccgcccagcacgcgtgttgggagtgtttcgggccgctggag
gtcgactacgacgccaccgcgctggccaaggtcacccgcgagcagatcgagagtggaccg
gacaacatctggcgctacgccgcgctgctgcccgccggggtcgacgccgccacccgggtc
accctgaatccgggcatgaccccgttggtcaaggccgacaacctcgctgctgagttgggt
atgaaagcgttgtgggtcaaggacgacagcgccaaccccacccactcgttcaaggaccgg
gtcgtgtcggtggcgctgacggcggcatcgcagctgggcttcgaccggttcgcgtgcgcg
tcgacgggcaacctcgccaactcggtggccgcccacgcggcgcgcgccggtaaaccgtcc
atcgtgttcatcccctacgacctggaacccggcaaggtcatcaccaccgcagtctatggt
ggacagctggtggcgatcgagggttcctacgacgacgtcaaccggctgtgcagcgaactg
accgagaccgacgagttcgagaacaccgcgttcgtcaacgtcaacgtgcggccgttctac
gccgaggggtccaagacgctgggctacgaggtcgccgaacagctgggctggcggctgccg
cgacaggtcgtcatcccgatggcctcgggcgagctgctcaccaaggtggacaaggctttc
accgagatgggcgagatcgggctcgtcgacccgtccgaggtcaaggtgttcggcgcccag
tcgagcggctgcaacccgatcgcgaccgcgctgcgcgcgggcaccgacgagatcactccg
gtcaagccgaccggcatcgccaagtcgctgaacatcggtgatccggccgcgggcccttac
gcgatcgagtcggtgcgtcgcaccggtggctggatggccgatgtggacgacgacgagatc
cgcgaggggattcggctgttggcccgcaccacgggcgtgttcgccgagaccgccggtggg
gtcgtggtcgcgaccttgaagaagctgctggccgagggccgtctcgacccggaggccgag
accgtcatctacaacaccggcgagggtttgaagacgctggacgcggtgacggccgggccg
acccaccaggtgaagccgtcgctgaagtcggtcaaggaagctgggttgctcagctag

DBGET integrated database retrieval system