KEGG   Stackebrandtia nassauensis: Snas_0573Help
Entry
Snas_0573         CDS       T01194                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sna  Stackebrandtia nassauensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Snas_0573
   01230 Biosynthesis of amino acids
    Snas_0573
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_0573
  Energy metabolism
   00680 Methane metabolism
    Snas_0573
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Snas_0573
Enzymes [BR:sna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Snas_0573
Exosome [BR:sna04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Snas_0573
  Exosomal proteins of melanoma cells
   Snas_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
604573..605325
Genome map
AA seq 250 aa AA seqDB search
MTATLVLLRHGESEWNAKNLFTGWVDVDLTAKGEDEARRGGALLVENDLLPDVVHTSRQR
RAIRTAEISLHACDRHWIDVKRSWRLNERHYGALQGKNKAETLAQYGEEQFMTWRRSYDV
PPPPIDRDDEYSQADDPRYAELPPELAPLTECLKDVLDRSLPYWYDSIVPDLKAGKTVLV
AAHGNSLRALVKHLDGISDAEISKLNIPTGMPLRYDLDLDTMRPLKTGGVYLDPEAAEKA
AAAVAAQGKK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctactttggtgctgctgcgacacggcgaaagcgaatggaacgccaagaacctg
ttcaccggctgggtcgacgtcgacctgaccgccaagggcgaggacgaggcccggcgcggc
ggcgcgctgctggtcgagaacgacctgctgcccgacgtcgtccacacctcccggcagcgt
cgcgccatccgcaccgccgagatctcgctgcacgcctgcgaccggcactggatcgacgtc
aagcggtcctggcggctcaacgaacgccactacggtgcgctgcaagggaagaacaaggcc
gagaccctcgcccagtacggcgaggaacagttcatgacctggcgccgctcctacgacgtc
ccgccgccgcccatcgaccgcgacgacgagtactcccaggccgacgacccgcgttacgcc
gaactcccgccggagctggcgccgctgaccgaatgcctcaaggacgtgctggaccggtcg
ctgccgtactggtacgacagcatcgtccccgacctgaaggccggcaagaccgtgctggtc
gccgcgcacggcaactcgctgcgggccctggtcaagcacctggacggcatctccgacgcc
gagatctccaagctcaacattcccaccgggatgccgctgcgctacgacctcgacctggac
acgatgcggccgctgaagaccggcggcgtgtacctcgacccggaggccgccgagaaggcc
gccgccgcggttgccgcccagggtaagaagtag

DBGET integrated database retrieval system