KEGG   Stackebrandtia nassauensis: Snas_0652Help
Entry
Snas_0652         CDS       T01194                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sna  Stackebrandtia nassauensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Snas_0652
Enzymes [BR:sna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Snas_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
684638..685471
Genome map
AA seq 277 aa AA seqDB search
MTDVCVVGSLNIDVAARVANLPRPGETVSASDLSRAPGGKGANQALAAARAGAETMLMGR
IGDDSAGSEYLAGLGERGVDCLAVVVTDATPSGHALIAVNEAGENTIIVAPGANAAVTTS
DVDRWRSQIADARVLLLQFELPDEVTAHAARLAKQSDTTVVLNPSPFKPVDPELLADIDI
LVVNELEQSELGDTGVSTVVTLGADGARWDDVHVPSPSVEHVDTTGAGDAFTGTFAAALA
SGADKTAALEAAVAAGSAACEHHGAQGWVFGEAESGD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtctgcgttgtcggttccctcaacatcgacgtggccgcgcgagtcgcgaac
ctgcccaggcccggcgagacggtctcggcgagcgacctgtcccgcgccccgggcggcaag
ggcgccaaccaggcactggccgccgcccgcgccggagccgagaccatgctgatgggacgc
atcggcgacgactcggccggatccgagtacctcgccgggctcggcgaacgcggcgtcgac
tgcctggcggtcgtggtgaccgacgcgaccccctcggggcacgcgctcatcgccgtgaac
gaggcgggggagaacaccatcatcgtggcaccgggagccaatgccgccgtgaccacttcg
gacgtcgaccggtggcggtcgcagatcgccgacgcccgggtgttgttgctgcagttcgag
ttgcccgacgaggtgaccgcccacgcggcccggctggccaaacagtccgacaccaccgtg
gtgctcaacccgtccccgttcaagcccgtcgaccccgagctgctggccgacatcgacatc
ctcgtggtcaacgaactggaacagtccgagctcggcgacaccggtgtgtccacagtggtg
acgctcggtgccgacggcgcccgctgggacgacgtccacgtgccctcgccgtccgtcgaa
cacgtcgacaccaccggcgccggagacgcgttcaccggcaccttcgccgccgcgctcgcg
tccggtgccgacaagaccgccgcgctggaggcggccgtggcggccggatcggccgcgtgc
gaacaccacggcgcccagggctgggtcttcggcgaagccgagtccggcgactag

DBGET integrated database retrieval system