KEGG   Stackebrandtia nassauensis: Snas_1009Help
Entry
Snas_1009         CDS       T01194                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00900  Terpenoid backbone biosynthesis
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Snas_1009
Enzymes [BR:sna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Snas_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADD40719
JGI: Snas_1009
UniProt: D3QA07
Position
1071576..1072523
Genome map
AA seq 315 aa AA seqDB search
MTGALAFDDGSQAVRVRVPAKINLHLGVGDRRADGYHDLTTVYQGISLYDEVTVIAGQQP
GVRVEVFGDDAEAVPLGTDNLAVKAVLALGEEFGVAPAVTVRIAKRIPIAGGLAGGSADA
AAALVACSRLWGMPFTDRLVKVAAGLGSDVPFCLSGGTALGTGHGERVEEVTANGRYHWV
VATADGQLSTPAVYAEVDRLRESGIGSYSSAVTELLEALRTGRAEELAPQLRNDMTEAAM
SLRPQLREILTAGADDGALAALLSGSGPTTLFLARDVHHATALAGRLRMRRLAREVHCVH
APAFVSVGLSPAQPG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggagcactggccttcgacgacggcagccaggccgtgcgggtccgggtgcccgcc
aagatcaacctgcacctgggggtcggcgaccggcgcgcggacggataccacgacctgacc
accgtctaccagggcatctcgctgtacgacgaggtcaccgtgatcgccgggcagcagccc
ggcgtgcgggtggaggtcttcggcgacgacgccgaggcggttccactggggaccgacaac
ctggccgtgaaggcggtgctcgcgctcggcgaggagttcggcgtcgcaccggcggtgacg
gtgcggatcgccaagcgcatcccgatcgccgggggcctggcgggcggcagtgccgacgcc
gccgccgcgctggtggcgtgttcgcggctgtgggggatgccgttcaccgaccggctggtc
aaggtggccgccgggctcggcagcgacgtcccgttctgcctgagcgggggtaccgcgctg
ggcaccgggcacggcgagcgcgtcgaggaggtcaccgccaacggccgctaccactgggtg
gtggccacggcggacggccagctgtcgacgcccgccgtctacgcggaggtggaccggctg
cgcgagtccggcatcgggtcctactcgtcggcggtcaccgaactgctggaggcgttgcgc
accggccgggccgaggagctggcgccccagctgcgcaacgacatgaccgaggcggcgatg
tcgctgcgcccgcagctgcgcgagatcctcaccgccggggccgacgacggcgctctggcg
gcgctgctgtcgggttccggccccacgacgctgttcctggcccgcgacgtccaccacgcc
accgcgctggcgggacggctgcgtatgcgacggctggcccgcgaggtgcactgtgtacac
gctccggcgttcgtgagcgtcggcttaagccctgctcagcccggctaa

DBGET integrated database retrieval system