KEGG   Stackebrandtia nassauensis: Snas_1168Help
Entry
Snas_1168         CDS       T01194                                 

Definition
D-aspartate oxidase (EC:1.4.3.1)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
sna  Stackebrandtia nassauensis
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sna00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sna00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:sna00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:sna00311]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1251710..1252666
Genome map
AA seq 318 aa AA seqDB search
MTGPQGYDALVVGAGVSGLTTAVVLAEAGLAVRVMTSDPPLRTVSAMAGASWGPFLAGHE
AVPRWSAVSRAVFVQLAAEYGSGVHLSSGVEAYQNMDAAPRWATEVPDFRDCELGEYPTG
YKGAWRYTIPLVDMPSYLSYLSQRLSYCGGGIDVIAPLTSLSVPLSVAPVVVNCTGLGAR
ELLDDVDVVPCRGQLTVVENPGITDFFQDNIDGDDLTCIFPHGDKVVLGGTTETNVDAMT
YDPNQERQILDRCARIDPRLAGARVVERRVGLRPQRSRIRVERDPNLDGLIHNYGHGGSG
VTLSWGCAMDVLKLVRQR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaccacagggttatgacgcgctggtggtcggtgcgggagtctccgggctgacc
accgcggtggtgttggccgaggccggactggcggtccgggtcatgacgagcgatccacca
ctgcggacggtctcggcgatggccggagcgagctggggaccgtttctggccgggcacgag
gcggtgccgcgctggagcgcggtgagccgggcggtgttcgtccagctggccgccgagtac
ggcagcggggtgcacctgtcgagcggggtcgaggcctaccagaacatggacgccgccccc
cgctgggccaccgaggtgcccgacttccgcgactgcgaactgggggagtaccccaccggc
tacaagggagcgtggcggtacaccatcccgctggtcgacatgcccagctacctcagctac
ctgagccagcggctgagctactgcggtggcggcatcgacgtcatcgcgccgttgacctcg
ctgtcggtcccgctgagcgtcgccccggtcgtcgtcaactgcaccggcctgggggccagg
gaactgctcgacgacgtcgacgtggtgccgtgccggggccagctgaccgtggtggagaac
cccggcatcaccgacttcttccaggacaacatcgacggcgacgacctgacctgcatcttc
ccgcacggcgacaaggtggtccttggcggcacgaccgagaccaacgtggacgcgatgacc
tacgacccgaaccaggaacgccagatcctggaccgctgcgcccgcatcgacccccggctc
gccggggcccgggtggtggaacgccgtgtcggactgcgcccgcagcgctcccgcatccgg
gtggaacgcgaccccaacctcgacggcctcatccacaactacggccacggcggttccggc
gtgacgctgtcgtggggctgcgccatggacgtcctgaagctggtccggcagcgctga

DBGET integrated database retrieval system