KEGG   Stackebrandtia nassauensis: Snas_1357Help
Entry
Snas_1357         CDS       T01194                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sna  Stackebrandtia nassauensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Snas_1357
Enzymes [BR:sna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Snas_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1433526..1434800
Genome map
AA seq 424 aa AA seqDB search
MFSAVDVIRAKRDGGELTTAQIDWVIDAYTKGVVADEQMSALAMAILLNGANDREIADWT
AAMIASGERLDLSGVGKPTVDKHSTGGVGDKITLPLAPLVAAFGVAVPQLSGRGLGHTGG
TLDKLESIPGWRANLSNAEFIARLSDPGAVVCAAGDDLAPADRRLYALRDVTGTVESIPL
IASSIMSKKIAEGTDALVLDVKVGSGAFMKDAEQARRLAETMVRLGDAHGVRCTALLTDM
DTPLGRTAGNALEVTESLEVLAGGGPADVVELTVALAREMLALAGKPDADPAAALADGRA
MDAWRAMISAQGGDVDAKLPVAPESEEVRAESDGVVARMDAYAVGVAAWRLGAGRARKSD
PVSAGAGVEILKTVGETVSAGEPLLRLHTEDVSTFAAARTTLDGAIDIGGSTAKRQLIMA
RIGG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
ttgttcagtgccgttgacgtcatccgtgccaagcgcgatggcggggagttgaccaccgcc
cagatcgactgggtcatcgacgcctacaccaagggtgtggtcgccgatgagcagatgtcg
gcgctggcgatggcgatcctgctcaatggggcgaacgatcgtgagatcgcggactggacc
gcggcgatgatcgcgtcgggggagcggttggacctgtccggggtgggtaagcctactgtg
gataaacactcgaccgggggcgtgggggacaagatcacgttgccgttggcgccgctggtg
gcggcgttcggggtggcggtgccgcagttgtcggggcgggggctcggtcacaccgggggc
actttggacaagctggagtcgattccggggtggcgcgccaatctgtccaatgcggagttc
atcgcgcggttgagtgatccgggcgcggtggtgtgtgccgccggggacgatctggcgccc
gccgaccgtcggctgtacgcgttgcgcgatgtcaccgggaccgtcgagtcgattccgttg
atcgcctcgtcgatcatgagcaagaagatcgccgagggcaccgatgccctggtcctggac
gtgaaggtcggttcgggcgcgttcatgaaggacgccgagcaggcccgcaggctcgccgag
accatggtgcggctgggtgacgcgcacggggtgcggtgcaccgcgctgttgaccgacatg
gacactccgctgggccggaccgccggcaacgcgctcgaggtcaccgagtcgctggaggtg
ctggccgggggtggaccggccgatgtggtggagctgaccgtggccctggcccgggagatg
ctggcgctggcgggtaagccggacgccgatccggccgcggcgctggccgacggtcgcgcc
atggacgcctggcgggccatgatctccgcgcagggcggcgatgtcgacgccaagttgccg
gtggcgccggagtcggaggaggtgcgggccgagtccgacggtgtcgtcgcccgcatggac
gcctacgccgtgggtgtggcggcgtggcggttgggtgccggacgggcgcgcaagtccgac
ccggtgtcggccggagccggagtcgagatcctgaagaccgtcggcgagacggtgtcggcc
ggggaaccgttgctgcgcttgcatactgaggatgtatcgacgttcgcggcggctcgcacc
accttggacggagctatcgacatcggagggtcgacggcgaaacgccagctgatcatggct
cgtatcggtgggtaa

DBGET integrated database retrieval system