KEGG   Stackebrandtia nassauensis: Snas_1364Help
Entry
Snas_1364         CDS       T01194                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sna  Stackebrandtia nassauensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Snas_1364
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Snas_1364
Enzymes [BR:sna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Snas_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1439468..1441270
Genome map
AA seq 600 aa AA seqDB search
MPRPRLFTTLALTAVLALTGCAPTASDDDGDTKVDASAKARDWAERQLKSLSLEEKVGQM
FTHYAYGQTADTTESADVKRNQKLHGVDNAKQLIEKYHLGGIIYFGWSNNLANPGQVAGL
SNGMQKTAMSQGGEIPLLVSTDQETGTVVRLGPPATEWPGNMALGAGRDRGDARDTAAIA
GVELRAVGINQNFAPSGDVNVNPQNPVIGVRSYSSDPKLVAKFTGEQVKGYQGRHGTSAT
VKHFPGHGDTHEDSHTDLPRIEHTKEQWKKLDAPPFKAAIKSGVDTVMSAHIQFPALDAS
EKPATLSKPILTGLLREELGFDGVIVTDSLGMQGVRELYTDAEIPVMAIKAGVDQLLMPA
DLKVAYEAVLAAVKSGEITEKRIDKSVKRLLTLKYLRGVVKNPYVDPDKVDDTVGTEDHL
ATAQAITDKTTTLVKNDGDALPLSKDTGKVFVAGDGANTTSILAKQIGKLGPATEALNTG
ADPNAATISGAVEKAKQADVAVVATNTVRAHPAQADLVKALRDSGTKVVVVGVKEPYDIN
RFPEVDSYVASYGYNTPVLTAVAKVLFGEVDPRGKLPVTIPKADDPDATLYEFGHGLSYE
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgccccgccctcgcctgttcaccacactcgccctcaccgccgtactggctctcaccgga
tgcgcccccaccgcctccgacgacgacggcgacacgaaggtcgacgccagcgccaaggcc
cgtgactgggccgaacgccaactcaagtcgctcagtcttgaggagaaggtcggccagatg
ttcacccactacgcctacggccagaccgccgacaccaccgagtcggccgatgtcaaacgc
aaccagaaacttcacggcgtcgacaacgccaagcagctgatcgagaagtaccacctcggc
ggaatcatctacttcggatggtcgaacaacctcgccaaccccggccaggtcgccggactg
tccaacgggatgcagaagaccgcgatgtcccagggcggcgagataccgctgctggtgtcc
accgaccaggagaccggcaccgtggtgcggctgggcccaccggccaccgaatggcccggc
aacatggcgctgggcgccggacgcgaccgcggcgacgcccgcgacacggcggccatcgcc
ggggtcgagctgcgcgccgtgggcatcaaccagaacttcgcgccctcgggcgacgtcaac
gtcaacccgcagaacccggtcatcggggtgcgctcgtacagctccgacccgaaactggtc
gccaagttcaccggcgaacaggtcaagggctaccagggccgccacggcaccagcgccacc
gtgaagcacttcccgggccacggcgacacccacgaggacagccacaccgacctgccgcgc
atcgagcacaccaaggaacagtggaagaagctggacgcgccgccgttcaaggccgccatc
aagtccggtgtcgacaccgtgatgtcggcgcacatccagttcccggcgctggacgcgtcc
gagaaacccgccaccctgtccaagccgatcctgaccggactgctgcgtgaggaactgggc
ttcgacggcgtgatcgtcaccgactcgctggggatgcagggcgtgcgcgagctgtacacc
gacgccgagatccccgtcatggccatcaaggccggggtcgaccagctgctgatgcccgcc
gacctgaaggtcgcctacgaagcggtgctggccgccgtcaagagcggtgagatcaccgag
aagcgcatcgacaagtcggtgaagcgactgctgacgctgaagtacctgcgcggcgtcgtc
aagaacccctatgtggaccccgacaaggtcgacgacaccgtcggcaccgaggatcacctg
gccaccgcccaggcgatcaccgacaagaccacgacactggtcaagaacgacggcgacgcg
ctgccgctgtcgaaggacaccggcaaggtcttcgtggccggggacggcgccaacaccacg
tccatcctggccaaacagatcggcaagctgggtccggccaccgaggcgctcaacaccggc
gccgaccccaacgccgccaccatctccggggcggtcgagaaggccaaacaggccgacgtc
gcggtggtggccaccaacaccgtccgcgcccacccggcccaggccgacctggtgaaagcc
ttgcgcgacagtggaaccaaggtggtcgtcgtcggggtcaaggaaccctacgacatcaac
cggttcccggaggtcgactcctatgtggcctcctacggttacaacacgccggtgctgacc
gccgtcgccaaggtgctgttcggcgaggtggacccgcgcggcaagctgcccgtcacgatt
cccaaggccgacgaccccgacgcgacgttgtacgagttcgggcacggcctctcctacgag
taa

DBGET integrated database retrieval system