KEGG   Stackebrandtia nassauensis: Snas_1382Help
Entry
Snas_1382         CDS       T01194                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sna  Stackebrandtia nassauensis
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Snas_1382
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Snas_1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1462298..1464046
Genome map
AA seq 582 aa AA seqDB search
MSKVRSGSATHYDVVVIGSGFGGSVAALRLTEKGYRVGVLETGARFDDPGQPDPRRRHAA
LPRNSWRLRKFLWAPRLGLRGIQRVHLIRGRKGSRVLVLAGAGVGGGSLVYANTLYRPGG
EFFTDPQWAGIADWESELTPAYDQASRMLGVVDNPVHTPADAAMKTVAKRLGVADSFHYT
RVGVHFGDGPEPVADPYFGGAGPERSGCVACGSCMTGCRQGAKNMLTENYLYLAERAGAV
IHPLTTVTRLRPREEGGYRVDTVRTGPWGRGRRCFTADQVIVAAGTYGTQTLLHRMRDNG
DLPGLSKRLGWLTRTNSEAILGAMRFGRKGEDHSKGLAITSSIHPDANTHIEPVRYGPGS
NAMGALSTILIDKDQSHRWRALLAYALKHPADALRLPYLRHWSRRTVVALVMQNRDNSIR
VSLKRGRLRAEPGHGEPNPTWIPVGHKATRYLAEEIGGLPGGTWLEMWDIPTTAHFLGGC
VIGADPDSGVVDAYHRVFGQPGLHVVDGSAVSANPGVNPSLTITAQAERAMSLWPNKGEA
DPRPAPGQPYRRVEPVAPRQPAVPADAPGALRYLAVNSLNHA
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggtgcgttccgggtccgcgacgcactacgacgtcgtcgtgatcggctcgggt
ttcggcggcagcgtcgcggcgctgcggttgaccgagaagggttaccgcgtcggggtgctg
gagaccggcgcgcggttcgacgaccccggccagcccgacccccggcggcggcacgccgcg
ctaccgcgcaactcctggcggctgcgcaagttcctgtgggcgcccaggctggggctgcgc
ggtatccagcgggttcacctgatccggggccgcaagggctcgcgggtgctggtgctcgcg
ggcgccggagtgggcggcgggtcgctggtgtacgcgaacacgctgtaccggccgggcggc
gagttcttcaccgatccacagtgggccgggatcgcggactgggaaagcgaactgacgccc
gcctacgaccaggcgtcgcggatgctcggcgtcgtcgacaaccccgtgcacacgcccgcc
gacgccgcgatgaagacggtggcgaaacggctcggtgtcgccgacagcttccactacacc
cgcgtcggcgtgcacttcggcgacgggcccgagccggtcgccgacccctacttcggcggc
gccgggcccgagcgttccggctgcgtcgcctgcggttcctgcatgaccggttgccgccag
ggcgccaagaacatgctcaccgagaactacctgtacctggccgaacgcgccggagccgtc
atccatccactcacgaccgtcacccggctgcggccccgcgaggagggcggataccgcgtc
gacaccgtccgcaccggaccgtggggacgcggccgccgctgtttcaccgccgatcaggtg
atcgtcgccgccgggacctacggcacccagacgctgctgcatcgcatgcgcgacaacggg
gacctgccggggctgtccaagcggctgggctggctgacccgcaccaactccgaggcgatc
ctgggcgcgatgcggttcggcaggaagggcgaggaccacagcaagggcctggccatcacc
tcgtcgatccaccccgacgccaacacccacatcgagccggtgcgctacgggcccggctcc
aacgcgatgggcgcgctgtcgacgatcctcatcgacaaggaccagtcgcaccggtggcgt
gccctgctcgcctacgcgctcaaacaccccgccgacgcgctgcggctgccgtacctgcgg
cactggtcgcggcgcaccgtcgtcgcgctggtgatgcagaaccgcgacaactcgatccgg
gtcagcctcaaacgcggcaggctgcgcgccgaacccgggcacggcgaacccaatccgacg
tggatcccggtggggcacaaggcgacccggtacctggccgaggagatcggcggcctgccc
ggcggcacctggctggagatgtgggacatcccgaccaccgcgcacttcctgggcggctgc
gtcatcggcgccgaccccgactccggggtcgtcgacgcgtaccaccgggtgttcgggcag
ccgggcctgcacgtcgtcgacggctcggcggtgtcggcgaacccgggcgtcaacccgtcg
ctgaccatcaccgcccaggccgagcgcgccatgtcgctgtggcccaacaagggtgaggcc
gatccgcgtcccgcgcccggccagccctaccggcgggtggagccggtcgcgccccgacag
cccgcggtccccgccgacgcgccgggagcgctgcgatacttagcggtgaattcacttaat
cacgcgtaa

DBGET integrated database retrieval system