KEGG   Stackebrandtia nassauensis: Snas_1400Help
Entry
Snas_1400         CDS       T01194                                 

Definition
(GenBank) DNA-formamidopyrimidine glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sna00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Snas_1400
Enzymes [BR:sna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Snas_1400
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Snas_1400
DNA repair and recombination proteins [BR:sna03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Snas_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS zf-TFIIB Ribosomal_S13 FbpA CobT Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ADD41107
JGI: Snas_1400
UniProt: D3PV54
Position
complement(1483938..1484798)
Genome map
AA seq 286 aa AA seqDB search
MPELPEVEALADFLRRRAVSHEVKRVDVASITALKTFDPPPTALHGRRITAVDRHGKFLD
LDADGTHLIFHLARAGWLRWNDKLAATPLRPGKHPLALRLALDDGSGFDLSEAGTKKRLA
VYVVSDPAQVPGIAGLGPDPLAESFTEAAFAAVLSGRRTQIKGLLRDQKLIAGIGNAYSD
EILHAARMSPFKLADSLTDTDVSVLYEAMVDTLRTAVAASSGSAAKDLKAHKHDSLRVHG
RAGQPCPVCGDTIAEVSFADSALQYCPTCQTGGRKLADRRMSRLLK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctacccgaggtggaggcgctcgcggacttcctgcgccgccgggcggtgtcg
cacgaggtcaaacgcgtcgacgtcgcctcgatcaccgcgctgaagaccttcgacccgccc
ccgacggcgctgcacggccgccggatcaccgccgtggaccggcacggcaagttcctcgac
ctggacgccgacggcacccacctgatcttccacctggcccgcgccggttggctgcgctgg
aacgacaagctcgcggccacgccgctgcggcccggcaaacacccgctggcgctgcggctg
gccctcgacgacggttccgggttcgacctgtccgaggccggaacgaagaaacggctggcc
gtgtacgtcgtgtccgaccccgcgcaggtccccggcatcgccggtctcgggcccgatccg
ctggccgagtcgttcaccgaggcggcgttcgcggcggtgctgtcgggccgccgcacccag
atcaagggcctgctgcgggaccagaaactgatcgcgggcatcggcaacgcctactccgac
gagatcctgcacgccgcccggatgtcgccgttcaagctcgccgactcgctcaccgacacc
gacgtgtccgtcctctatgaagcgatggtcgacacgctgcggaccgcggtggcggcgtcg
tcgggttcggcggccaaggatctcaaggcgcacaagcacgacagcctgcgcgtccacggc
cgcgccgggcagccgtgcccggtgtgcggcgacaccatcgccgaggtctcgttcgccgac
tcggcgctgcagtactgcccgacctgccagaccggcggcaggaaactcgccgaccgtcgg
atgtcgcggctgctgaagtag

DBGET integrated database retrieval system