KEGG   Stackebrandtia nassauensis: Snas_1504Help
Entry
Snas_1504         CDS       T01194                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00071  Fatty acid degradation
sna00280  Valine, leucine and isoleucine degradation
sna00281  Geraniol degradation
sna00310  Lysine degradation
sna00360  Phenylalanine metabolism
sna00362  Benzoate degradation
sna00380  Tryptophan metabolism
sna00410  beta-Alanine metabolism
sna00627  Aminobenzoate degradation
sna00640  Propanoate metabolism
sna00650  Butanoate metabolism
sna00903  Limonene and pinene degradation
sna00930  Caprolactam degradation
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01212  Fatty acid metabolism
Module
sna_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Snas_1504
   00650 Butanoate metabolism
    Snas_1504
  Lipid metabolism
   00071 Fatty acid degradation
    Snas_1504
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snas_1504
   00310 Lysine degradation
    Snas_1504
   00360 Phenylalanine metabolism
    Snas_1504
   00380 Tryptophan metabolism
    Snas_1504
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Snas_1504
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Snas_1504
   00281 Geraniol degradation
    Snas_1504
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Snas_1504
   00627 Aminobenzoate degradation
    Snas_1504
   00930 Caprolactam degradation
    Snas_1504
Enzymes [BR:sna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Snas_1504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ADD41208
JGI: Snas_1504
UniProt: D3PW51
Position
complement(1588640..1589659)
Genome map
AA seq 339 aa AA seqDB search
MEFHPGRIATDEVGFARHGVLGRIRLHRPKAINALTHAMIAAMLAQLDDWASDASVRAVV
IDGEGERGLCAGGDVRQLREAILHEVGDPESFWDDEYRLNAAIADYPKPFVAIMDGVVMG
GGVGISAYGSLRLTTPRSKVAMPETAIGFFPDVGGLHPMSRAPGELGTHAALTGLPMTGA
DAVLCGLADTVVEPADIESIIDALAAGTPPAELALPVPPPAELEAERDWIDACYRGEDAV
AIVAALRGRPEPAARRAAEVIASRSPLSVAVTLAAIRKAATMSLAEVLDQDRRLGRHFVT
EPDFVEGVRAVLVDRDDNPRWRHDGLADVTADEVARMFT
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggagtttcatccgggccggatcgccaccgacgaggtgggtttcgcgcggcacggcgtc
ctggggcggatccggttgcatcggcccaaggccatcaacgcgctcacgcacgcgatgatc
gccgcgatgctggcgcagctggacgactgggcgagcgacgcgtcggtgcgcgcggtggtg
atcgacggcgagggtgagcggggactgtgcgcgggcggcgatgtccggcagctgcgggag
gcgatcctgcacgaggtcggtgaccccgagagcttctgggacgacgagtaccggctcaac
gcggccatcgccgactaccccaaacccttcgtggccatcatggacggtgtggtgatgggc
ggcggcgtcggcatctccgcgtacggctcgctgcgcctgacgactccccgttccaaggtc
gcgatgcccgagaccgcgatcgggttcttccccgacgtcggcggcctgcatccgatgtcc
cgcgccccgggcgagctgggcacgcacgcggcgctgacgggcctgccgatgaccggggcc
gacgcggtgctgtgcgggctggccgacaccgtcgtcgaacccgccgacatcgagtccatc
atcgacgctctcgccgccggaacgccaccggccgagctcgccctgcccgtcccgccgccg
gccgaactcgaagccgagcgggactggatcgacgcctgctatcgcggtgaggacgccgtc
gcgatcgtcgcggcgttgcgcggtcgccccgaaccggccgcccgccgcgccgccgaggtc
atcgcgtcgcgcagtccgctgtcggtggcggtgacgctggccgcgatccgaaaggccgcg
acgatgtccctcgccgaggtcctggaccaggaccgcaggctgggccgccacttcgtcacc
gaacccgacttcgtggagggggtgcgcgcggtgctggtcgaccgcgacgacaacccccgc
tggcggcacgacggcctcgccgacgtcaccgccgacgaggtcgcgcgcatgttcacctga

DBGET integrated database retrieval system