KEGG   Stackebrandtia nassauensis: Snas_1519Help
Entry
Snas_1519         CDS       T01194                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sna  Stackebrandtia nassauensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Snas_1519
Enzymes [BR:sna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Snas_1519
    3.5.1.-  
     Snas_1519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1606371..1606940
Genome map
AA seq 189 aa AA seqDB search
MARALIIVDVQNDFCEGGSLAVAGGASVAADISAMVAAEPGRWDRIVATRDRHIDPGRHF
STEPDFVDSWPPHCVVGTDGADFHPDLTVSPEAIFDKGAYSAAYSGFEGSAGEDDLAGWL
RGHETTAVDIVGIATDHCVRATALDAAREGFDTTVLLDLTAGVAADTVETALTELRAAGV
TLAGTPRVG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgcgctcatcatcgtcgatgtccaaaacgacttctgtgaaggcgggtcgctg
gcggtggccgggggcgcgagcgtcgccgccgacatctccgccatggtggccgccgaaccc
ggccgctgggaccggatcgtggccacccgcgaccggcacatcgacccgggacggcacttc
tcgaccgaacccgacttcgtcgactcctggccgccgcactgcgtggtgggcaccgatggc
gccgacttccatcccgacctgaccgtctcaccggaggcgatcttcgacaagggcgcctac
tcggcggcctactccggtttcgagggcagcgcgggggaggacgacctggcgggctggctg
cgcggccacgagaccaccgcggtcgacatcgtcggcatcgccaccgaccactgtgtccgg
gccaccgccctggacgcggcccgcgagggcttcgacaccaccgtcctgctcgacctgacc
gccggggtcgccgccgacaccgtcgagacggcgctgaccgaactgcgcgccgccggagtg
accctcgccggtaccccgcgcgtgggctag

DBGET integrated database retrieval system