KEGG   Stackebrandtia nassauensis: Snas_1545Help
Entry
Snas_1545         CDS       T01194                                 

Definition
non-canonical purine NTP pyrophosphatase rdgB/HAM1 family
Orthology
K02428  
dITP/XTP pyrophosphatase [EC:3.6.1.19]
Organism
sna  Stackebrandtia nassauensis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sna00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sna00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1627317..1627898)
Genome map
AA seq 193 aa AA seqDB search
MRLLLATRNRKKLTELERILAEHSAVELVGLGDVEEYPEAPETALTFAGNALAKARDAVR
HTGLTCVADDSGIAVDALNGMPGVFSARWAGRHGDDEANLELLLGQLGDVPDEERGAAFV
CAAALVRPDGSEEVVHGEVRGRIIREPLGDNGFGYDPIFVPDGFAVTTAQLSAVEKDAIS
HRGKAFRQLAKLL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgaggttgttgttggcgacccgcaaccgtaagaagctgaccgagctggagcggattctg
gctgagcacagtgcggtcgagctggtggggttgggcgatgtggaggagtatcccgaggca
ccggagacggcgttgacgttcgcgggcaatgcgttggcgaaggctcgggatgccgtgcgg
cacacggggttgacgtgtgtggccgatgattcggggatcgccgtggacgctttgaacggg
atgccgggggtgttctcggcgcgttgggcggggcggcatggcgacgatgaggcgaacctg
gagctgttgttggggcagttgggtgatgtgcccgacgaggagcggggtgccgcgttcgtg
tgtgcggcggcgttggtgcgtccggacgggtccgaggaggtcgtgcacggtgaggtgcgg
ggccggattattcgggaaccgttgggggacaatggttttggttatgacccgattttcgtg
ccggacgggttcgcggtgacgacggcgcagttgtcggccgtggagaaggacgcgatcagc
catcgggggaaggcttttcgccagctggcgaaactgttgtag

DBGET integrated database retrieval system