KEGG   Stackebrandtia nassauensis: Snas_1545Help
Entry
Snas_1545         CDS       T01194                                 

Definition
non-canonical purine NTP pyrophosphatase rdgB/HAM1 family
Orthology
K02428  
XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
sna  Stackebrandtia nassauensis
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Snas_1545
Enzymes [BR:sna01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Snas_1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1627317..1627898)
Genome map
AA seq 193 aa AA seqDB search
MRLLLATRNRKKLTELERILAEHSAVELVGLGDVEEYPEAPETALTFAGNALAKARDAVR
HTGLTCVADDSGIAVDALNGMPGVFSARWAGRHGDDEANLELLLGQLGDVPDEERGAAFV
CAAALVRPDGSEEVVHGEVRGRIIREPLGDNGFGYDPIFVPDGFAVTTAQLSAVEKDAIS
HRGKAFRQLAKLL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgaggttgttgttggcgacccgcaaccgtaagaagctgaccgagctggagcggattctg
gctgagcacagtgcggtcgagctggtggggttgggcgatgtggaggagtatcccgaggca
ccggagacggcgttgacgttcgcgggcaatgcgttggcgaaggctcgggatgccgtgcgg
cacacggggttgacgtgtgtggccgatgattcggggatcgccgtggacgctttgaacggg
atgccgggggtgttctcggcgcgttgggcggggcggcatggcgacgatgaggcgaacctg
gagctgttgttggggcagttgggtgatgtgcccgacgaggagcggggtgccgcgttcgtg
tgtgcggcggcgttggtgcgtccggacgggtccgaggaggtcgtgcacggtgaggtgcgg
ggccggattattcgggaaccgttgggggacaatggttttggttatgacccgattttcgtg
ccggacgggttcgcggtgacgacggcgcagttgtcggccgtggagaaggacgcgatcagc
catcgggggaaggcttttcgccagctggcgaaactgttgtag

DBGET integrated database retrieval system