KEGG   Stackebrandtia nassauensis: Snas_1919Help
Entry
Snas_1919         CDS       T01194                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sna  Stackebrandtia nassauensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Snas_1919
Enzymes [BR:sna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Snas_1919
Exosome [BR:sna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Snas_1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2034843..2036336
Genome map
AA seq 497 aa AA seqDB search
MTEQYIAAIDQGTTSSRCIVFDHSGSIVSMDQKEHEQIFPKPGWVEHDAAEIWTNVQEVV
KGAIEKGNLSKDQIKAIGITNQRETTLVWDKETGEPVHNAIVWQDTRTDKLCQELGSNVG
QERFREKVGLPLATYFAGPKIRWLLDNVEGLRERAERGEVLFGTMDSWVIWNLTGGTHVI
DVTNASRTMLMNLRTLAWDESILDAMKIPAAMLPEIRSSAEVYGNAVGYLEGVPVASALG
DQQAALFGQTCFNVGEAKSTYGTGTFLLLNTGTEPVVSKKGLLTTVGYKIGDQPAAYALE
GSIAVTGSLVQWLRDNLGLIKAAPEVEDLANTVDDNGGCYVVPAFSGLFAPHWRSDARGV
IAGLTRYINKGHIARATLEATSWQTREVVDAMDSDSGVPLTELKVDGGMTANNMLMQHLS
DVLNVPVVRPVVAETTCLGAAYAAGLATGYWSDIPSLRANWQKDAEWTPDMDSELRDREY
AGWNKAVQRTLGWVDQD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcaatacatcgccgcgatcgaccagggaaccacgtcaagtcgctgtatcgtc
ttcgaccactctggatccattgtgtccatggaccagaaggaacacgagcagatcttcccc
aagccgggatgggtggagcacgacgccgccgagatctggaccaacgtccaggaggtcgtc
aagggcgccatcgagaagggcaacctctccaaggaccagatcaaggccatcggcatcacc
aaccagcgtgagaccaccctggtgtgggacaaggagaccggcgagccggtccacaacgcc
atcgtgtggcaggacacccgcaccgacaaactgtgccaggagctgggctccaacgtcggc
caggaacggttccgcgagaaggtcggtctgccgctggccacctacttcgccggacccaag
atccgctggctgctcgacaacgtcgagggactgcgcgaacgcgccgagcgcggcgaggtc
ctgttcggaaccatggacagctgggtgatctggaacctcaccggtggcacccacgtcatc
gacgtcaccaacgccagccgcaccatgctgatgaacctgcgcaccctcgcctgggacgag
tccatcctggacgccatgaagatcccggccgcgatgctgcccgagatccgctcctccgcc
gaggtctatggcaacgccgtcggctacctggagggcgtaccggtcgcctcggcgctgggc
gaccagcaggcggccctgttcggacagacctgcttcaacgtcggcgaggccaagtccacc
tacggcaccggcaccttcctgctgctcaacaccggcaccgagccggtggtgtccaagaag
ggcctgctgaccaccgtcggctacaagatcggtgaccagcccgccgcctacgcgctggag
ggctccatcgccgtcaccggttcgctggtgcagtggctgcgcgacaacctgggcctcatc
aaggccgccccggaggtcgaggacctggccaacaccgtcgacgacaacggcggctgctac
gtcgtcccggcgttctccggcctgttcgccccgcactggcgcagcgacgcccgcggcgtg
atcgccggtctgacccggtacatcaacaagggacacatcgcccgcgccacgctggaggcc
acctcgtggcagacccgcgaggtcgtcgacgcgatggactccgactccggcgtcccgctg
accgaactgaaggtcgacggcggcatgaccgccaacaacatgctcatgcagcacctgtcc
gacgtgctcaacgtgccggtggtgcgtccggtggtcgccgagaccacctgcctgggcgcc
gcctacgcggccggcctggccaccggctactggtcggacatcccgtccctgcgggccaac
tggcagaaggacgccgagtggaccccggacatggactccgagctgcgcgaccgtgagtac
gcgggctggaacaaggccgtccagcgcacgctgggctgggtcgaccaggactag

DBGET integrated database retrieval system