KEGG   Stackebrandtia nassauensis: Snas_1926Help
Entry
Snas_1926         CDS       T01194                                 

Definition
(GenBank) Arginase/agmatinase/formimino glutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00220  Arginine biosynthesis
sna00330  Arginine and proline metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01130  Biosynthesis of antibiotics
sna01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Snas_1926
   00330 Arginine and proline metabolism
    Snas_1926
Enzymes [BR:sna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Snas_1926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADD41622
JGI: Snas_1926
UniProt: D3PZE8
Position
2042702..2043589
Genome map
AA seq 295 aa AA seqDB search
MLDAPSNLGLRPPTPTTVPGCAKAPGALRDQGLVARLGARDAGCLTAPRFDTGDWQPGDG
VSQAVEIAEYSRKLADRIDGILDEGEFPLVLGGDCSILLGAGVAMRRRAKARGGKCGLVF
MDGHSDFRHPGNAPYVGAAAGEDLALVTGRGQPDLTDIDGLRPYFPPASTAVLGIRDGDA
HRMELTATGIAHRTVPQLRSAGAIRSAEWAIDRLGDVGGFWLHVDVDILDSSVMPAVDSP
DSGGIAHGELQQLIEVFTSYEECLGMELTVFDPDYDPDGEYAAAIVDTLVRGLTS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgctggacgcgccctcgaacctggggttgcgtccacccacccccaccacggttcccggc
tgcgccaaggcccccggcgcgctgcgcgaccaggggttggtcgcgcggttgggggctcgg
gatgccggttgtctgaccgcgccccggttcgacacgggggattggcagccgggggacggg
gtttcgcaggctgtcgagatcgcggagtactcgcggaagttggccgatcggatcgacggg
attctcgatgagggggagtttccgttggtgttgggtggggactgctcgattctgttgggg
gcgggggtggcgatgcggcgtcgggccaaggcccggggtggcaagtgcgggttggttttc
atggacgggcactcggatttccggcatccggggaacgctccttatgtgggggccgcggcg
ggggaggatttggcgttggtgaccgggcgggggcagccggatttgaccgatatcgatggg
ttgcggccgtattttccgcccgcgagtacggcggtgttggggattcgggacggggacgcg
catcggatggagttgaccgccaccggtatcgcgcatcggacggtgccgcagttgcgcagt
gccggggcgattcgcagtgccgagtgggcgatcgatcggttgggggatgtgggtgggttc
tggctgcacgtggacgtcgacatcctggattcctcggtgatgcccgccgtcgacagtccg
gattcggggggtatcgcgcatggggagttgcagcagctcatcgaggtgttcacgtcctat
gaggagtgcctggggatggagttgacggtgttcgatcccgactacgatcccgacggggag
tacgcggcggcgatcgtcgacacgttggttcggggccttaccagttag

DBGET integrated database retrieval system