KEGG   Stackebrandtia nassauensis: Snas_1926Help
Entry
Snas_1926         CDS       T01194                                 

Definition
Arginase/agmatinase/formimino glutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Snas_1926
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Snas_1926
Enzymes [BR:sna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Snas_1926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2042702..2043589
Genome map
AA seq 295 aa AA seqDB search
MLDAPSNLGLRPPTPTTVPGCAKAPGALRDQGLVARLGARDAGCLTAPRFDTGDWQPGDG
VSQAVEIAEYSRKLADRIDGILDEGEFPLVLGGDCSILLGAGVAMRRRAKARGGKCGLVF
MDGHSDFRHPGNAPYVGAAAGEDLALVTGRGQPDLTDIDGLRPYFPPASTAVLGIRDGDA
HRMELTATGIAHRTVPQLRSAGAIRSAEWAIDRLGDVGGFWLHVDVDILDSSVMPAVDSP
DSGGIAHGELQQLIEVFTSYEECLGMELTVFDPDYDPDGEYAAAIVDTLVRGLTS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgctggacgcgccctcgaacctggggttgcgtccacccacccccaccacggttcccggc
tgcgccaaggcccccggcgcgctgcgcgaccaggggttggtcgcgcggttgggggctcgg
gatgccggttgtctgaccgcgccccggttcgacacgggggattggcagccgggggacggg
gtttcgcaggctgtcgagatcgcggagtactcgcggaagttggccgatcggatcgacggg
attctcgatgagggggagtttccgttggtgttgggtggggactgctcgattctgttgggg
gcgggggtggcgatgcggcgtcgggccaaggcccggggtggcaagtgcgggttggttttc
atggacgggcactcggatttccggcatccggggaacgctccttatgtgggggccgcggcg
ggggaggatttggcgttggtgaccgggcgggggcagccggatttgaccgatatcgatggg
ttgcggccgtattttccgcccgcgagtacggcggtgttggggattcgggacggggacgcg
catcggatggagttgaccgccaccggtatcgcgcatcggacggtgccgcagttgcgcagt
gccggggcgattcgcagtgccgagtgggcgatcgatcggttgggggatgtgggtgggttc
tggctgcacgtggacgtcgacatcctggattcctcggtgatgcccgccgtcgacagtccg
gattcggggggtatcgcgcatggggagttgcagcagctcatcgaggtgttcacgtcctat
gaggagtgcctggggatggagttgacggtgttcgatcccgactacgatcccgacggggag
tacgcggcggcgatcgtcgacacgttggttcggggccttaccagttag

DBGET integrated database retrieval system