KEGG   Stackebrandtia nassauensis: Snas_1931Help
Entry
Snas_1931         CDS       T01194                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sna  Stackebrandtia nassauensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Snas_1931
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Snas_1931
Enzymes [BR:sna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Snas_1931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2051678..2053150)
Genome map
AA seq 490 aa AA seqDB search
MPDRQELRQLALRTLIPGFSGTTAPRWALDLLDEGLGGYCLFAHNVADPQQLSELNSSLR
QANKDVLIAIDEEGGDVTRLHSASGSHYPGNAALGAVDDPELTAAVHQSMGAELAAAGVT
VDFAPSVDVNVEDDNPVIGTRSFGRDPQGVARHAVAAVRGLHRAGIIACAKHFPGHGATV
VDSHFEVPTVDIPLSELRERELVPFRAVIDSGIELIMSGHIRVPELTGDAPGTMSRAAMH
DLLRGELGFDGAIVTDAMEMRGASGAIGMPEAVVRAIAAGCDLICTGGELQKRGPMTEVV
NAVADAVATAVIDGRLPYERLADAVRRGDVLREWQRENRGSRAPHALGLAAARRAITVEG
TVPALSNPLIVQIDSTANIAVGESQWGVTPLLAKHLPHAQIRNVTPENASVAQISALADN
RPVIVVARDTHRRPASKGFVEGLAASGHDVVLVEMGWPAAWRPEGVAAYVASFGAAAVNA
EATVEVLLGS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgccagaccgccaagaacttcgccagctcgcactgcgcaccctgattcccggtttcagc
gggactacggcgccacggtgggcccttgacctcctggacgaggggctaggcggatactgc
ctcttcgcccataatgtcgccgacccacagcaactctccgaactgaactcaagcctcaga
caggccaataaggacgtcctgatagcaatcgatgaggagggaggcgatgttacgcgcctt
cacagtgccagtggcagccactaccccggtaacgcggcccttggggccgtagacgatccg
gagttgaccgccgcggttcaccagtccatgggggccgagttggccgccgccggagtcacc
gtcgacttcgcgccgtcggtggacgtcaatgtggaggacgacaaccccgtcatcggcacc
cgctcgttcggacgcgacccgcagggcgtggcccggcacgcggtcgcggcggtgcgcggg
ctgcaccgggccgggatcatcgcctgcgccaaacacttccccggtcacggcgccaccgtc
gtcgactcccacttcgaggtgccgacggtggacatcccgctgtcggagctgcgggaacgt
gaactggtgccgttccgcgccgtcatcgactcgggcatcgaactcatcatgagcggccac
atccgggtccccgaactcaccggcgacgcgcccggcaccatgtcccgcgcggccatgcac
gacctgctgcgcggcgaactgggcttcgacggcgccatcgtcaccgacgcgatggagatg
cgcggagccagtggcgccatcgggatgcccgaggccgtggtccgcgcgatcgcggccggg
tgcgacctgatctgcaccggcggcgaactccagaaacgcggtcccatgaccgaggtcgtc
aacgctgtcgccgacgcggtcgccaccgccgtcatcgacggtcggctgccctacgagcga
ctcgccgacgccgtgcgtcgtggcgacgtgctgcgggagtggcagcgcgagaaccggggt
tcccgagccccgcacgccctggggcttgccgccgcccgacgcgccatcaccgtggaggga
accgttccggcactgagcaacccgctcatcgtccagatcgactccaccgccaacatcgcg
gtcggcgaatcgcagtggggcgtcacgccgttgttggccaagcacctgccgcacgcccag
atccgcaacgtcacccccgagaacgccagcgtcgcccagatctccgcgctggccgacaac
cgcccggtcatcgtcgtggcccgcgatacccaccggcgcccggcgtccaagggcttcgtc
gagggactggcggcttccggccacgacgtggtgctcgtcgagatgggctggcccgcggcc
tggcggccggagggcgtggcggcctacgtcgcctcgttcggggcggcggcggtcaacgcc
gaggccaccgtcgaggtgctgttgggttcgtga

DBGET integrated database retrieval system