KEGG   Stackebrandtia nassauensis: Snas_2349Help
Entry
Snas_2349         CDS       T01194                                 

Definition
group 1 glycosyl transferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
sna  Stackebrandtia nassauensis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Snas_2349
Enzymes [BR:sna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Snas_2349
Glycosyltransferases [BR:sna01003]
 Polysaccharide
  Storage polysaccharide
   Snas_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2489338..2490582)
Genome map
AA seq 414 aa AA seqDB search
MLSWEYPPVLVGGLGRSVHALATALAAEGHDVTVATRHGDHPDGSAAAFDETVDGVRVVR
APQDPPLFPFTGETLLEWTMAFNHSLTRTALRACRTQDFDVIHAHDWLVTHAAVTLKHHL
DLPLVATIHSTEAGRHHGWLPDDTSRAIHSIEWWLTYESRRVLVCSKHMRWEVNRLFELP
EDKTLVVPNGVDARVFAVEDTVPDREAGPVVVSAGRLVHEKGVQDLIDAAAILREKHPGL
RVLIAGEGPHEEELRDQAVRRGLEDTVEFLGFVEGAALPRLLGGADCFAIPSRYEPFGMV
ALEAAAAGTPVVAGRSGGLAEFIVDGETGLTHTPARPEELAEAISRVLSEPELARRLRDG
GRAMVSQRFGWGPIATAVIAAYAQSEIGERAVEAELAARELRVVIPEGNLLDAG
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctgggaatacccgcccgtcctcgtcggtggcctcggccgcagtgttcacgcc
ctggccacggcgctggccgccgaggggcacgacgtcaccgtggccacccgccacggtgac
caccccgacggttcagcggcggccttcgacgagaccgtcgacggggtgcgcgtcgtgcgc
gccccgcaggacccgccgctgttcccgttcaccggcgagacgctgctcgagtggacgatg
gcgttcaaccactcgctgacgcgtacggcgctgcgggcctgccgtacccaggacttcgac
gtcatccacgcgcacgactggctggtcacccacgcggcggtgaccctcaagcaccatctc
gacctgccgctggtggcgacgatccactccaccgaggccgggcgtcaccacggctggttg
cccgacgacacctcccgcgccatccactcgatcgaatggtggctgacctacgagtcccgc
cgggtgctggtgtgctccaagcacatgcgctgggaggtcaaccggctgttcgagctgccc
gaggacaagacgctcgtggtgcccaacggcgtcgacgcccgggtgttcgccgtcgaggac
accgtcccggaccgggaggcggggccggtggtggtcagcgccgggcggctggtgcacgag
aagggcgtccaggatctcatcgacgcggccgcgatcctgcgggagaagcaccccgggttg
cgggtgctgatcgccggtgagggtccgcacgaggaggaactgcgggaccaggcggtgcgg
cggggccttgaggacactgtggagttcctcggtttcgtcgagggcgcggcgctgccgcga
ctgttgggcggggcggactgtttcgcgatccccagccgctacgagccgttcggcatggtg
gcgctggaggcggcggcggccgggaccccggtggtggccggacgcagcggcggcctggcc
gagttcatcgtggacggtgagaccggtctcacccacacccccgcgcggcccgaggaactg
gccgaggcgatctcacgggtgctgtcggaaccggagctggcccggcgactgcgggacggc
ggccgggcgatggtgagccagcggttcggctgggggccgatcgcgacggccgtcatcgcc
gcctacgcgcagtccgagatcggcgagcgcgccgtggaggcggagctggcggcgcgggag
ctgcgggtcgtgatccccgagggcaacctgctggacgcgggctga

DBGET integrated database retrieval system