KEGG   Stackebrandtia nassauensis: Snas_2511Help
Entry
Snas_2511         CDS       T01194                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00260  Glycine, serine and threonine metabolism
sna00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01130  Biosynthesis of antibiotics
sna01230  Biosynthesis of amino acids
Module
sna_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Snas_2511
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Snas_2511
Enzymes [BR:sna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Snas_2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA KDGP_aldolase His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ADD42193
JGI: Snas_2511
UniProt: D3Q618
Position
2650875..2651675
Genome map
AA seq 266 aa AA seqDB search
MSVTPAFEAAKRAGRAALVGYLPAGFPTVDESIAAIETMIDSGCDVIEVGLPYSDPVMDG
HAIQRAAAMALAGGCRTREVLRVVEAVAGKGVPILVMTYWNPIERYGVDAFARDFAAAGG
AGLITPDLIPDEAAEWIAASDAHDLDRVFLVAPSSTKERIALTVNACRGFVYAQSIMGIT
GARDSTSSAAPGLVERTRAATDLPIGVGLGVRDGDQAAEVATFADGVIVGSAMVSCLLDA
PDEKAGRKALGSLTAELAEGVARGAG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcacgcccgctttcgaagcggcgaaacgggccggccgcgccgccctcgtcggc
tacctgcccgccgggttccccaccgtggacgagtcgatcgccgcgatcgagaccatgatc
gactccggttgcgacgtcatcgaagtcggactgccctattcggaccccgtcatggacggg
catgccatccagcgcgccgccgccatggcgctggcgggcggctgccgcacccgtgaggta
ctgcgggtggtcgaggctgtcgcgggcaagggcgtgccgattctcgtcatgacctactgg
aacccgatcgaacgctacggcgtcgacgccttcgcgcgcgacttcgccgccgccgggggt
gccggactcatcaccccggacctgatccccgacgaggccgccgagtggatcgccgcctcc
gacgcccacgacctggaccgggtcttcctggtcgcgccgtcctcgaccaaggaacgcatc
gcgctgacggtcaacgcctgccgcggcttcgtgtacgcccagtcgatcatgggcatcacc
ggcgcccgcgacagcacctcctcggcggcgccgggcctggtggagcgcacccgcgccgcc
accgacctgcccatcggcgtcggtctcggcgtccgcgacggcgaccaggccgccgaggtc
gcgaccttcgccgacggcgtcatcgtcggctcggcgatggtgtcgtgcctgctggacgcc
cccgacgagaaggccggtcggaaagcgctgggctccctgaccgccgaactcgccgagggc
gtggcccgcggcgccggatag

DBGET integrated database retrieval system