KEGG   Stackebrandtia nassauensis: Snas_2736Help
Entry
Snas_2736         CDS       T01194                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sna  Stackebrandtia nassauensis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Snas_2736
Enzymes [BR:sna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Snas_2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2878704..2880677
Genome map
AA seq 657 aa AA seqDB search
MSLTRVPGLLYGGDYNPEQWPPHVWREDARLMAEAGVNLVTLGVFSWARLEPAPGEYDLD
WLAEIIDLLWEHGVAVDLATGTASPPPWFVRDHPRSLPVTADGTRLEFGSRQHYCPSSPE
FRAAATALTTKMAQRFADHPALALWHVSNEYGDELQECFCEVSAADFRRWLRDRYRDLDA
FNHAWGTDFWSQRYTSFDQVEPPRAAPGPINPTQQLDWRRFCSDAMLACYRSEKEVLDRL
SPGVPVTTNFMSMLKALDYWEWARHEDLVSDDAYPDPADPKAHIGAALNYDLMRSLRGGQ
PWLLLEQAPSAVSWREVNVPKTPQQYRLWSIQTVARGADGVMHFQWRASQAGAEKFHSAM
LPHGGTTARGWERTVRMGAELRSLAPVAGHRTTAQVAMLLDWDSWWALEIDQHPSALVLL
KEQIRAWYEPLWEANITVDFVPVTADLSAYRAVLAPNLYLTDAATASKLRAFTDGGGTLV
VGFFSGIVDRDDHIVPGGHPGALRDLLGLTVDEFWPLPAGERVALDQPGAYGTVWRDWIV
PSGADVEIRYADGELAGRPAVTRHGNTWYLSTLPDPATLSGILRRALTAASVTPVGQATP
GVELCRRGPYLFALNHTDATATVTSVGDRVDLLSGKKYSDHVDLGPLEVVCLSPEDS
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgacccgcgtacccggcctgctgtacggcggcgactacaaccccgaacagtgg
ccgccgcacgtgtggcgcgaggacgcccggctgatggccgaggccggggtgaacctggtg
acgctcggcgtcttcagctgggcccgcctggaaccggcacccggcgaatacgacctggac
tggctggccgagatcatcgacctgctgtgggaacacggcgtcgcggtcgacctggccacc
ggcaccgcgtcaccgccgccgtggttcgtgcgcgaccatccacggtcgctgccggtcacc
gccgacggcacccggctcgaattcggttcccggcagcactactgtccgtcctcaccggag
ttccgggccgccgccaccgcgctgaccacgaagatggcgcagcggttcgccgaccacccc
gcgctcgccctgtggcacgtgtccaacgagtacggcgacgaactgcaggagtgcttctgc
gaggtgtcggcggccgacttccggcgctggctacgcgaccgctaccgcgacctcgacgcc
ttcaaccacgcctggggcaccgacttctggagccagcgctacacctccttcgaccaggtg
gaaccaccccgcgcggcgccgggccccatcaacccgacccagcagctggactggcgccgg
ttctgctccgacgccatgctggcctgctaccgctccgagaaggaggtgctggaccggctg
tcaccgggcgtgcccgtcaccacgaacttcatgagcatgctcaaggccctggactactgg
gaatgggcacggcacgaggacctggtctccgacgacgcctaccccgaccccgccgacccc
aaggcccacatcggcgcggcgctcaactacgacctgatgcgctcactgcgcggcggccag
ccgtggctgctgctggaacaggcaccctcggcggtgagctggcgcgaggtcaacgtcccc
aagaccccgcaacagtatcgactgtggagcatacagacggtggcgcgcggcgcagacggc
gtcatgcacttccaatggcgcgcatcccaagccggggccgagaagttccactcggcgatg
ctgccgcacggcggcaccaccgcgcgcggctgggaacgcaccgtccgcatgggagccgaa
ctgcgatccctggccccggtcgcgggccaccgcaccaccgcgcaggtggcgatgctgctg
gactgggactcgtggtgggcactggagatcgaccagcacccctcggcgctggtgctgctc
aaggaacagatccgggcctggtacgaaccactgtgggaagccaacatcaccgtcgacttc
gtaccggtgaccgccgacctgtcggcctaccgcgccgtgctggccccgaacctgtacctg
accgacgcggccaccgcgtcgaagctgcgcgccttcaccgacggcggcggaaccctggtg
gtcgggttcttcagcggcatcgtcgatcgcgacgaccacatcgtccccggtggacacccc
ggcgcgctgcgggacctgctgggcctgaccgtcgacgagttctggccgctcccggccggt
gaacgcgtcgcactcgaccagcccggagcctacggaaccgtatggcgcgactggatcgtc
ccctccggcgcggacgtcgagatccgttacgcggacggggaactggccggacgtccggcc
gttactcggcacggaaacacctggtacctgtccactctgcccgacccggcgaccctgtcc
ggcatcctgcgccgcgcgctgacggcggcgtcggtgaccccggtcggccaagccaccccc
ggcgtcgaactgtgccgccgggggccgtacctgttcgccctcaaccacaccgacgcgacc
gccaccgtgacctcggtcggcgaccgcgtggacctgctgtccggcaagaagtattccgac
catgtcgacctcggccccctcgaggtcgtctgcctgtccccggaggactcatga

DBGET integrated database retrieval system