KEGG   Stackebrandtia nassauensis: Snas_2829Help
Entry
Snas_2829         CDS       T01194                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sna  Stackebrandtia nassauensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sna00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2977668..2978330)
Genome map
AA seq 220 aa AA seqDB search
MASPAPNPANLSSLSEMKVPHAIPAQRTLRVVHDREDVDLDAAHKAVTDLLVALGRNPMS
EHLADTPRRVAEAYAEMLTPREFNLTTFPNDEGYDELVLARGIPVQSLCQHHLLPFHGVA
HVGYLPGERILGLSKLARVVELFARDLQVQERLTKQVADWLRDHLAPKGVGVVIEAEHMC
MALRGVRATGSRTLTSAMHGQLRDDARSRQEFFALTGTNG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccccggcccccaaccccgcgaacctgtctagtctgagtgagatgaaggtgccg
cacgcgatcccggcccagcgcacgttgcgtgtggtccacgaccgcgaggatgtggacctg
gacgccgcgcacaaggccgtcaccgatctgctggtcgcgctgggtcgcaatccgatgtcg
gagcacctggccgacaccccgcgacgggtggccgaggcctacgccgagatgctcacgccg
cgcgagttcaacctgacgacgtttcccaacgacgagggttacgacgaactggtgctcgcc
cgtgggattccggtgcagtcgttgtgccagcaccatctgctgccgttccacggcgtcgcg
cacgtcgggtacctgcccggggaacggattctcgggctgtcgaagctggcgcgggtggtg
gagttgttcgcccgcgaccttcaggtacaggaacgactgaccaaacaggtcgccgactgg
ttgcgggatcacctggcgcccaagggtgtcggcgtggtcatcgaggccgagcacatgtgc
atggcgctgcggggagtgcgcgccaccggttcgcgcaccctgacctcggcgatgcacgga
cagctgcgtgacgacgcccgctcgcggcaggagttcttcgcgctcaccggcaccaacggc
taa

DBGET integrated database retrieval system