KEGG   Stackebrandtia nassauensis: Snas_2829Help
Entry
Snas_2829         CDS       T01194                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00790  Folate biosynthesis
sna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Snas_2829
Enzymes [BR:sna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Snas_2829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ADD42505
JGI: Snas_2829
UniProt: D3Q8D1
Position
complement(2977668..2978330)
Genome map
AA seq 220 aa AA seqDB search
MASPAPNPANLSSLSEMKVPHAIPAQRTLRVVHDREDVDLDAAHKAVTDLLVALGRNPMS
EHLADTPRRVAEAYAEMLTPREFNLTTFPNDEGYDELVLARGIPVQSLCQHHLLPFHGVA
HVGYLPGERILGLSKLARVVELFARDLQVQERLTKQVADWLRDHLAPKGVGVVIEAEHMC
MALRGVRATGSRTLTSAMHGQLRDDARSRQEFFALTGTNG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccccggcccccaaccccgcgaacctgtctagtctgagtgagatgaaggtgccg
cacgcgatcccggcccagcgcacgttgcgtgtggtccacgaccgcgaggatgtggacctg
gacgccgcgcacaaggccgtcaccgatctgctggtcgcgctgggtcgcaatccgatgtcg
gagcacctggccgacaccccgcgacgggtggccgaggcctacgccgagatgctcacgccg
cgcgagttcaacctgacgacgtttcccaacgacgagggttacgacgaactggtgctcgcc
cgtgggattccggtgcagtcgttgtgccagcaccatctgctgccgttccacggcgtcgcg
cacgtcgggtacctgcccggggaacggattctcgggctgtcgaagctggcgcgggtggtg
gagttgttcgcccgcgaccttcaggtacaggaacgactgaccaaacaggtcgccgactgg
ttgcgggatcacctggcgcccaagggtgtcggcgtggtcatcgaggccgagcacatgtgc
atggcgctgcggggagtgcgcgccaccggttcgcgcaccctgacctcggcgatgcacgga
cagctgcgtgacgacgcccgctcgcggcaggagttcttcgcgctcaccggcaccaacggc
taa

DBGET integrated database retrieval system