KEGG   Stackebrandtia nassauensis: Snas_2981Help
Entry
Snas_2981         CDS       T01194                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Snas_2981
   01230 Biosynthesis of amino acids
    Snas_2981
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_2981
   00051 Fructose and mannose metabolism
    Snas_2981
   00562 Inositol phosphate metabolism
    Snas_2981
Enzymes [BR:sna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Snas_2981
Exosome [BR:sna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Snas_2981
  Exosomal proteins of bladder cancer cells
   Snas_2981
  Exosomal proteins of melanoma cells
   Snas_2981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3149888..3150670
Genome map
AA seq 260 aa AA seqDB search
MSDRKPLIAGNWKMNLNHFEAIALVQKLAFSLDEKQLSDVEVVVLPPFVDIRSVQTVIDG
DNLLLGFGAQDVSAHASGAYTGEISAAMLAKLGCTYVTVGHSERRQYHGEDDKLVGAKAK
AALANEITPILCVGEPLPVRESGEHVEHSVGQLLAAIEGLSSEQVDKLVVAYEPVWAIGT
GKTCAPDDAQEVIGALRAALAKDHPEAAEKVRILYGGSVKAGNVAQIMKKPDIDGALVGG
ASIDADEFVKICRFPEHNNV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccgcaagcctctcatcgccggcaactggaagatgaacctcaaccacttcgag
gccatcgcactggtgcagaagctggccttcagcctggacgagaagcagctgtcggacgtc
gaagtggtggtactgccgcccttcgtggacatccgcagcgtccagaccgtcatcgacggc
gacaacctgctgctgggcttcggcgcccaggacgtgtcggcgcacgcctcgggtgcctac
accggcgagatctcggcggcgatgctggccaaactcggctgcacctacgtgaccgtcggc
cactccgagcggcgccagtaccacggcgaggacgacaaactcgtcggcgccaaggcgaaa
gcggcgctggccaacgagatcaccccgatcctgtgcgtcggcgaaccgctgccggtgcgc
gaatccggggagcacgtcgagcactcggtgggccagctgctggccgcgatcgagggactg
tcgtccgaacaggtcgacaagctcgtggtcgcctacgaaccggtgtgggccatcggcacc
ggcaagacctgcgcgcccgacgacgcgcaggaggtcatcggcgcgctgcgcgcggcgctg
gccaaggaccaccccgaggccgccgagaaggtacgcatcctctacggcggttcggtcaaa
gcgggcaacgtcgcacagatcatgaagaagccggacatcgacggcgccctagtgggcggc
gcgagcatcgacgccgacgaattcgtgaagatctgtcgcttccctgagcacaacaacgtg
taa

DBGET integrated database retrieval system