KEGG   Stackebrandtia nassauensis: Snas_3126Help
Entry
Snas_3126         CDS       T01194                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
sna  Stackebrandtia nassauensis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Snas_3126
Enzymes [BR:sna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     Snas_3126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3301258..3302670)
Genome map
AA seq 470 aa AA seqDB search
MARIGVISISDGREYVQKDIGDFIAGYEDRLVASLEAAGHEVIRGEEQVTSNTVATAVAR
RVAARGVDLTVLHYAVWAFPHFTMLAADASPGPLLLLSTIDPAQPGMVGMLAAGGALDQI
GREHTRLWGDADDTELIDAIGVRASAAAAVSSLRGSTFGRIGGRPMGMYTAVANTDQWQR
EFGIDVEEIDQYEIVRRAELADASEKKHAREWLETNANVHYDGKKLTPELLERQIGSYMA
MRELIEEWNLDFTGIKGQPELTQYFATMDIAEAFLNDPYDWNGPKAPHVCATEADMDGAL
TMQLLKGITGTPVLFADVRHYHADRDVWDLCNSGQHATWYAARSDDPAVNLARVHLYPEV
FFFPAGGASVHHIAAPGEMTLARLTRLDGKYRMQLMHGEFQEFDDEVNTEMMRRSTPEWP
HAWARIHAPAATFLSRFGANHIHAVPGDRRAELRTVCELMGISLDEFTRD
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgcattggcgtgatcagcatttcggacggccgtgagtacgtgcaaaaggacatc
ggcgacttcatcgccggttacgaggatcgcctggtcgcgagcctggaagccgccgggcac
gaggtgatccggggcgaggagcaggtcacgtccaacaccgtggccaccgcggtggcgcgc
cgggtggcggcccggggcgtcgacctgaccgtgctgcactacgcggtgtgggcgttcccg
catttcacgatgctggccgccgacgcctcccccggtccgctgctgctgttgtccaccatc
gacccggcgcagccgggcatggtgggcatgctggccgccggtggcgcgctggaccagatc
ggccgcgagcacacccggctgtggggcgacgcggacgacaccgaactcatcgacgcgatc
ggggtgcgggccagcgccgcggcggcggtgtcgagcctgcgcggttccaccttcggccgg
atcggcggtcgtccgatgggcatgtacaccgccgtggccaacaccgaccagtggcagcgc
gagttcggcatcgacgtggaggagatcgaccagtacgagatcgtgcgccgcgcggagctg
gccgacgcgtccgagaagaagcacgcccgggaatggctggagaccaacgccaacgtccac
tatgacggcaagaagctcacgcccgagctgctggagcggcagatcggctcctatatggcg
atgcgggagctgatcgaggagtggaacctcgacttcaccggtatcaaggggcagccggaa
ctgacccagtacttcgccaccatggacatcgccgaggcgttcctcaacgacccctacgac
tggaacggccccaaggcgccgcacgtgtgcgccaccgaggccgacatggacggcgcgctg
acgatgcagctgctgaaggggatcaccggcacgccggtgctgttcgccgacgtgcggcac
taccacgccgaccgggacgtgtgggacctgtgcaactccgggcagcacgcgacctggtac
gccgcccgcagcgacgatccggccgtcaacctggcccgggtgcacctgtaccccgaggtg
ttcttcttccccgccggcggcgcctcggtgcaccacatcgccgcccccggcgagatgacg
ctggcgcggttgaccagactggacggaaagtaccggatgcagctgatgcacggtgagttc
caggaattcgacgacgaggtcaacaccgagatgatgcgacgctccacaccggagtggccg
cacgcgtgggcacgcatccacgcgcccgccgcgaccttcctgtcccggttcggcgccaac
cacatccacgccgtgcccggtgaccggcgcgccgagctgcggacggtgtgcgagctgatg
ggcatcagtctcgacgagttcacgagggactga

DBGET integrated database retrieval system