KEGG   Stackebrandtia nassauensis: Snas_3142Help
Entry
Snas_3142         CDS       T01194                                 

Definition
3-dehydroquinate synthase (EC:2.7.1.71 4.2.3.4)
Orthology
K13829  
shikimate kinase / 3-dehydroquinate synthase [EC:2.7.1.71 4.2.3.4]
Organism
sna  Stackebrandtia nassauensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Snas_3142
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Snas_3142
Enzymes [BR:sna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Snas_3142
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     Snas_3142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3319860..3321419
Genome map
AA seq 519 aa AA seqDB search
MSPILVLVGPPGSGKTTVGALLADRLGVSFRDTDADIEKLAGKAIPEIFVADGEEHFRAL
ETQAIAAALAEHDGVLALGGGAVLAETNRRLLAEAPVAFLSVELSAAVNRVGMGAGRPLL
ALNPRATLKALLDQRRPLYDEVADITVATDALTPDQVAEELAAFTGAPVSIHVGGDSPYE
VVIGREATIALTEHLDGAARVAILHAPPLREHARRVAAFVGETLECLLIEVPDAESAKTV
AVAEDCWNRLGQAGFTRTDVVVGIGGGAVTDLAGFVAACWLRGVRVVQLPTSILGMVDAA
VGGKTGVNTPSGKNLVGAFHPPAAVLCDLSTLDTLPESDRTAGLAEIVKCGYIADPRINE
LITANPKAATDPAGPLLANLVRRAVAVKAEVVSEDLKESGRRAILNYGHTFAHAIEKVED
YSWRHGDAVAVGMVYASVLGRLTGRVDLVDHTRDLLTAVGLPTSYRGAPFEQLLAAMRVD
KKAVGNTLRFILLDEVARPALVDDVTEDQLRQAYVEVSS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgatactggtacttgtcggcccgcccggcagcggtaagaccaccgtcggggcc
ctgttggccgaccggctgggcgtgtccttccgcgacaccgacgccgacatcgagaaactg
gcgggcaaggcgatcccggagatcttcgtggccgacggcgaggaacacttccgcgccctg
gagacccaggcgatcgcggcggcgctggccgaacacgacggcgtcctggcgctgggtggg
ggagcggtgctggccgagaccaaccggcgactgctggcggaggcgccggtggcgttcctg
tcggtggagttgtcggcggcggtcaaccgggtcgggatgggcgccggacgtccgctgctg
gccctcaacccgcgcgccaccctcaaggccctgctcgaccagcggcgtccgctgtacgac
gaggtcgccgacatcaccgtcgccaccgacgcgctgacccccgaccaggtcgccgaggaa
ctggcggccttcaccggcgcgccggtgtcgatccatgtcggcggcgacagcccctacgag
gtcgtcatcggacgcgaggcgaccatcgcgctgaccgagcacctcgacggggcggcccgg
gtggcgatcctgcacgcgccgccgctgcgcgagcacgcgcggcgggtcgcggccttcgtc
ggcgagacgctggagtgtctgctcatcgaggtgcccgacgccgagtccgccaagaccgtc
gcggtggccgaggactgctggaatcgcttgggacaggcgggtttcacccgcaccgacgtc
gtggtgggcatcggcggcggcgccgtgaccgacctggccggtttcgtggccgcctgctgg
ctgcgcggcgtgcgcgtggtccagctgcccacctcgatcctgggcatggtggacgccgcc
gtgggcggcaagaccggcgtcaacacgccctcgggcaagaacctggtcggcgcgttccac
ccgcccgccgccgtcctgtgtgacctatccacactcgacacgctgcccgagtccgaccgc
accgccgggctggccgagatcgtcaagtgcggctacatcgccgatccgcgcatcaacgaa
ctcatcaccgccaaccccaaggccgccaccgatcccgccggtccgctgctggccaacctg
gtgcgccgggcggtcgcggtcaaggccgaggtcgtgtcagaggacctgaaggaatccggc
cgccgcgccatcctcaactacgggcacaccttcgcccacgcgatcgagaaggtcgaggac
tactcgtggcgccacggcgacgcggtggccgtgggcatggtctacgcatccgtcctgggc
cgtctcaccggccgcgtcgacctggtcgaccacacccgcgacctgctgaccgccgtcggc
ctgcccacgagctatcgtggcgctccgttcgagcagctgctggccgcgatgcgcgtcgac
aagaaggccgtcggcaacaccctgcgcttcatcctgctggacgaggtcgcgcgcccggcg
ctggtcgacgacgtgaccgaagaccaactgcggcaagcctatgtggaggtgtcctcgtga

DBGET integrated database retrieval system