KEGG   Stackebrandtia nassauensis: Snas_3182Help
Entry
Snas_3182         CDS       T01194                                 

Definition
(GenBank) transcriptional regulator, XRE family
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00520  Amino sugar and nucleotide sugar metabolism
sna00550  Peptidoglycan biosynthesis
sna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Snas_3182
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Snas_3182
Enzymes [BR:sna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Snas_3182
Peptidoglycan biosynthesis and degradation proteins [BR:sna01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Snas_3182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase HTH_3 HTH_31 HTH_19 HTH_37 HTH_Crp_2 HTH_26 HTH_24 Sigma70_r4 YdaS_antitoxin HTH_25 MarR_2 HTH_23 MarR MqsA_antitoxin
Motif
Other DBs
NCBI-ProteinID: ADD42852
JGI: Snas_3182
UniProt: D3QBH0
Position
complement(3362671..3364212)
Genome map
AA seq 513 aa AA seqDB search
MSETPARTEDILRRIGTLIRDARKHRGLTQTQLADLLGTSQSAVNRIERGAQNLSVDMLN
RVSEALDSEFVTLGKPAAVHLRVRGGQELSGTIDVKTSKNAGVALLCASLLNRGKTTLRR
VARIEEVNRILRVMESMGVKYRWLEDNDLEIVPPAKLRLDNIDEDAARRTRSIIMFLAPL
LHDFDTFGLPYAGGCDLGTRTVEPHMMALRHFGLEVKAGAGEYHATVTRQVPPRPIVLIE
RGDTVTENALMAAARAGGVTVIRNASPNYMVQDLCFYLQKLGVRIDGVGTTTLTVHGVPR
IDRDVDYAPSEDPIEAMSLITAGIVTGSSITVARVPIEFLEIEVALLEEMGLDYSRGPEY
LAANGNTRLVDITVRPSTLIAPIDKVHPMPFPGLNIDNLPFFTLIAAYANGSTDIHDWVY
DNRAIYLTDLNKLGARITLMDPHRLRVDGPTHFSGAEVICPPALRPAVVLLLAMLAAKGT
SVLRDINVIHRGYEQLAERLSLLGASIEVFGDA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaacgccagcacgcaccgaagacatcctgcgccgcatcggcaccctgatccgc
gacgcccgcaaacaccgcggcctcacccaaacccagctggccgacctgctgggcaccagc
caaagcgcggtcaaccggatcgaacgcggcgcccaaaacctcagcgtcgacatgctcaac
cgggtctccgaggccctggactccgagttcgtcaccctcggcaaacccgccgcggtccac
ctgcgggtacgcggcggacaggaactgtcgggcaccatcgacgtcaagacctccaaaaac
gccggcgtcgccctgctgtgcgcgtcgttgttgaaccggggcaagaccacgctgcggcgg
gtggcgcgcatcgaagaggtcaaccggatcctgcgcgtcatggaatccatgggcgtcaaa
taccggtggctggaggacaacgacctggagatcgtgccgccggcgaagttgcggctggac
aacatcgacgaagacgccgcccgccgcacccgcagcatcatcatgttcctggcgccgctg
ctgcacgacttcgacaccttcggcctgccctacgccggcggctgcgacctgggcacccgc
accgtcgaaccccacatgatggcgctacgtcacttcggcctggaagtcaaagccggtgcc
ggggaataccacgccaccgtcacccggcaggtcccgccgcgacccatcgtgctgatcgaa
cgcggcgacaccgtcaccgaaaacgcgctcatggccgccgcccgcgcaggcggtgtcacc
gtcatcaggaacgcctcccccaactacatggtccaagacctgtgcttctacctgcaaaaa
ctcggggtgcggatcgacggcgtcggcaccaccaccctcaccgtccacggtgtgccccgc
atcgaccgcgacgtcgactacgcccccagtgaggaccccatcgaagcgatgagcctcatc
accgcaggcatcgtcaccggttcgtccatcaccgtggcgcgggtaccgatcgagttcctg
gaaatcgaggtcgcgctgttggaggagatgggcctggactactcccgcggccccgaatac
ctcgccgccaacggcaacacccgcctggtcgacatcaccgtgcgaccctccacgttgatc
gcccccatcgacaaggtccacccgatgccgttccccggcctcaacatcgacaacctgccg
ttcttcaccctgatcgcggcctacgccaacggatccaccgacatccacgactgggtctac
gacaaccgggcgatctacctgaccgacctgaacaaactcggcgcccgcatcaccctgatg
gacccgcaccggctgcgcgtcgacggccccacccacttctccggcgccgaagtcatctgc
ccgccggcactgcgccccgccgtggtgctgctgctggcgatgctggccgccaaaggcacc
tcggtactgcgcgacatcaacgtcatccacagaggatacgagcagttggcggaacggttg
agcctcctgggcgccagcatcgaagtattcggcgacgcttaa

DBGET integrated database retrieval system