KEGG   Stackebrandtia nassauensis: Snas_3237Help
Entry
Snas_3237         CDS       T01194                                 

Definition
(GenBank) Phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00030  Pentose phosphate pathway
sna01100  Metabolic pathways
sna01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Snas_3237
Enzymes [BR:sna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Snas_3237
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Snas_3237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ADD42907
JGI: Snas_3237
UniProt: D3QBM5
Position
complement(3414983..3417379)
Genome map
AA seq 798 aa AA seqDB search
MSKLEQLEQPALTDDELAAVDAYWRAANYLSVGQIYLLDNPLLTEPLRPEHIKPRLLGHW
GTTPGLNFCYAHLNRAIKALDLDMMFVTGPGHGGPALLANSWLEGSYSQAYPAVARDGKG
MRTLFRQFSFPGGVPSHVAPEVPGSIHEGGELGYSLAHAYGAAFDNPDLIVACVVGDGEA
ETGPLATSWHANKFCDPVGDGAVLPILHLNGYKIANPTVLARIPRDELDALLRGYGHKPY
YVEGHDPEAMHQAMAEVVDAAIADIRAIQRQARDGGPSRRPRWPMVVLRTPKGWTGPGSV
DGVPVEGTWRSHQVPLSGVRDNPDHLRQLEEWLRSYRPGELFDGDGAPVARLGELVPDGQ
RRMGANPHANGGLLLRDLELPDFRDYAVAVDQPGVTSSEPTRVLGRFLRDVLRDNADTAN
FRLFGPDETASNRLDAVYEVTGKAWQSPIVDTDENLSAHGRVVEVLSEHVCQGWLEGYLL
TGRHGLLSCYEAFVHIVDSMFNQHAKWLKVSRGLPWRRPVASLNYLLTSHVWRQDHNGFS
HQDPGFIDHVVNKKADIIRVYLPPDTNTLLSVGDHVLRSKNYVNVIVAGKNDSPNWLSVD
EAVLHCARGAGIWDWAGTEAEGEEPDVVLGCAGDAPTLEVLAAASLLRRHLPSLRVRVVN
VVDLMRLQSATEHPHGMTDREYDTLFTADRPVIFAYHGYPWLIHRLTYRRNGHDNLHVRG
YKEEGTTTTPFDMLVLNDMDRFQLVTDVIDRVPGLGRRAAGVRQSMQDNRTRHRYWVRQH
GEDLPEVRDWEWSDGRTG
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaactggagcaactggaacaacccgcgctgaccgacgacgaactggccgccgtc
gacgcgtactggcgggcggccaattacctgtcggtcgggcagatctatctgctggacaac
ccgttgctgaccgagccgctgcggccggagcacatcaagccgcggttgctggggcattgg
gggaccacaccggggctgaacttctgttacgcgcacctgaaccgggcgatcaaggccctc
gacctcgacatgatgttcgtgaccgggccgggccacggtggcccggcgctgctggccaac
agctggctggagggcagctacagccaggcgtatccggcggtggcccgggacggcaagggg
atgcggacgttgtttcggcagttctcgtttcccggcggcgtccccagccatgtggccccc
gaggtcccggggtccattcacgaaggcggggagctgggttactcgctggcgcacgcctac
ggtgccgcgttcgacaatcccgatctgatcgtggcgtgtgtggtgggtgacggcgaggcc
gagaccggcccgctggcgacgagctggcacgccaacaagttctgcgacccggtcggtgac
ggggcggtgttgccgattctgcacctcaatggctacaagatcgccaacccgacggtgctg
gcccggatcccccgcgacgaactggacgcgctgctgcgcggatacggccacaaaccatac
tatgtggagggtcacgatccggaggcgatgcatcaggccatggccgaggtcgtcgacgcc
gcgatcgccgatatccgggccatccaacgccaggcccgcgacggcgggccgagccgacgg
ccgcggtggccgatggtggtgttgcgaacccccaagggctggaccggtcccggcagcgtc
gacggggtgccggtggaggggacctggcggtcgcatcaggtgccgctgtccggggtgcgc
gacaacccggatcacctgcggcagctggaggagtggctgcggtcgtaccggccgggcgag
ttgttcgacggcgacggtgccccggtcgcgcggctgggggagctggtccccgacgggcag
cgacgcatgggcgccaatccgcacgccaacggcgggctgctgctgcgcgacctggagctt
cccgacttccgcgactacgcggtcgcggtggaccagcccggcgtcacctcgtccgaaccc
acccgggtgttgggccgtttcctgcgggatgtgctgcgcgacaacgccgatacggcgaac
ttccggctgttcgggcccgacgagaccgcttcgaaccggctggacgcggtgtacgaggtg
acgggcaaggcctggcagtctccgatcgtggacaccgacgagaacctgtccgcgcacggg
cgggtggtggaggtgttgtcggagcacgtgtgtcagggctggctggagggctatctgctg
acggggcggcacggtctgctgtcgtgttatgaggctttcgtccacatcgtggattcgatg
ttcaaccagcacgcgaagtggctgaaggtgtcgcggggcctgccgtggcggcggccggtg
gcgtcgttgaactatctgctgacctcgcacgtgtggcgtcaggaccacaatggtttctcg
catcaggatccgggtttcatcgaccatgtggtcaacaagaaagccgacatcatccgggtg
tatctgccgccggacaccaacacgctgctgtcggtcggggatcacgtgttgcgcagcaag
aactatgtcaacgtgatcgtggcgggtaagaacgacagccccaactggctcagcgtcgac
gaggcggtgctgcactgtgcccggggtgctgggatctgggactgggccggtaccgaggcc
gagggtgaggaacccgacgtcgtgttgggttgcgccggtgacgcgcccacactggaggtg
ctggccgcggcgtccctgctgcggcgacatcttccgtctctgcgggtgcgggtcgtcaac
gtcgtggacttgatgcggttgcagtcggcgacggagcacccgcacggcatgaccgatcgg
gagtacgacacgttgttcaccgctgatcggccggtgatcttcgcgtatcacgggtacccg
tggctgatccaccgtttgacgtaccgccgcaacggccacgacaacctccacgtgcgcggg
tacaaggaggaggggacgaccacgacgccgttcgacatgctggtgctcaacgacatggac
cggttccagctggtcaccgacgtcatcgaccgggtgccggggttgggtcgtcgtgccgcc
ggggtgcggcagtcgatgcaggacaaccggacccggcaccgctactgggtgcggcagcac
ggtgaggatctgccggaggtgcgtgactgggaatggtctgatgggcggacggggtga

DBGET integrated database retrieval system