KEGG   Stackebrandtia nassauensis: Snas_3237Help
Entry
Snas_3237         CDS       T01194                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
sna  Stackebrandtia nassauensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sna00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3414983..3417379)
Genome map
AA seq 798 aa AA seqDB search
MSKLEQLEQPALTDDELAAVDAYWRAANYLSVGQIYLLDNPLLTEPLRPEHIKPRLLGHW
GTTPGLNFCYAHLNRAIKALDLDMMFVTGPGHGGPALLANSWLEGSYSQAYPAVARDGKG
MRTLFRQFSFPGGVPSHVAPEVPGSIHEGGELGYSLAHAYGAAFDNPDLIVACVVGDGEA
ETGPLATSWHANKFCDPVGDGAVLPILHLNGYKIANPTVLARIPRDELDALLRGYGHKPY
YVEGHDPEAMHQAMAEVVDAAIADIRAIQRQARDGGPSRRPRWPMVVLRTPKGWTGPGSV
DGVPVEGTWRSHQVPLSGVRDNPDHLRQLEEWLRSYRPGELFDGDGAPVARLGELVPDGQ
RRMGANPHANGGLLLRDLELPDFRDYAVAVDQPGVTSSEPTRVLGRFLRDVLRDNADTAN
FRLFGPDETASNRLDAVYEVTGKAWQSPIVDTDENLSAHGRVVEVLSEHVCQGWLEGYLL
TGRHGLLSCYEAFVHIVDSMFNQHAKWLKVSRGLPWRRPVASLNYLLTSHVWRQDHNGFS
HQDPGFIDHVVNKKADIIRVYLPPDTNTLLSVGDHVLRSKNYVNVIVAGKNDSPNWLSVD
EAVLHCARGAGIWDWAGTEAEGEEPDVVLGCAGDAPTLEVLAAASLLRRHLPSLRVRVVN
VVDLMRLQSATEHPHGMTDREYDTLFTADRPVIFAYHGYPWLIHRLTYRRNGHDNLHVRG
YKEEGTTTTPFDMLVLNDMDRFQLVTDVIDRVPGLGRRAAGVRQSMQDNRTRHRYWVRQH
GEDLPEVRDWEWSDGRTG
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaactggagcaactggaacaacccgcgctgaccgacgacgaactggccgccgtc
gacgcgtactggcgggcggccaattacctgtcggtcgggcagatctatctgctggacaac
ccgttgctgaccgagccgctgcggccggagcacatcaagccgcggttgctggggcattgg
gggaccacaccggggctgaacttctgttacgcgcacctgaaccgggcgatcaaggccctc
gacctcgacatgatgttcgtgaccgggccgggccacggtggcccggcgctgctggccaac
agctggctggagggcagctacagccaggcgtatccggcggtggcccgggacggcaagggg
atgcggacgttgtttcggcagttctcgtttcccggcggcgtccccagccatgtggccccc
gaggtcccggggtccattcacgaaggcggggagctgggttactcgctggcgcacgcctac
ggtgccgcgttcgacaatcccgatctgatcgtggcgtgtgtggtgggtgacggcgaggcc
gagaccggcccgctggcgacgagctggcacgccaacaagttctgcgacccggtcggtgac
ggggcggtgttgccgattctgcacctcaatggctacaagatcgccaacccgacggtgctg
gcccggatcccccgcgacgaactggacgcgctgctgcgcggatacggccacaaaccatac
tatgtggagggtcacgatccggaggcgatgcatcaggccatggccgaggtcgtcgacgcc
gcgatcgccgatatccgggccatccaacgccaggcccgcgacggcgggccgagccgacgg
ccgcggtggccgatggtggtgttgcgaacccccaagggctggaccggtcccggcagcgtc
gacggggtgccggtggaggggacctggcggtcgcatcaggtgccgctgtccggggtgcgc
gacaacccggatcacctgcggcagctggaggagtggctgcggtcgtaccggccgggcgag
ttgttcgacggcgacggtgccccggtcgcgcggctgggggagctggtccccgacgggcag
cgacgcatgggcgccaatccgcacgccaacggcgggctgctgctgcgcgacctggagctt
cccgacttccgcgactacgcggtcgcggtggaccagcccggcgtcacctcgtccgaaccc
acccgggtgttgggccgtttcctgcgggatgtgctgcgcgacaacgccgatacggcgaac
ttccggctgttcgggcccgacgagaccgcttcgaaccggctggacgcggtgtacgaggtg
acgggcaaggcctggcagtctccgatcgtggacaccgacgagaacctgtccgcgcacggg
cgggtggtggaggtgttgtcggagcacgtgtgtcagggctggctggagggctatctgctg
acggggcggcacggtctgctgtcgtgttatgaggctttcgtccacatcgtggattcgatg
ttcaaccagcacgcgaagtggctgaaggtgtcgcggggcctgccgtggcggcggccggtg
gcgtcgttgaactatctgctgacctcgcacgtgtggcgtcaggaccacaatggtttctcg
catcaggatccgggtttcatcgaccatgtggtcaacaagaaagccgacatcatccgggtg
tatctgccgccggacaccaacacgctgctgtcggtcggggatcacgtgttgcgcagcaag
aactatgtcaacgtgatcgtggcgggtaagaacgacagccccaactggctcagcgtcgac
gaggcggtgctgcactgtgcccggggtgctgggatctgggactgggccggtaccgaggcc
gagggtgaggaacccgacgtcgtgttgggttgcgccggtgacgcgcccacactggaggtg
ctggccgcggcgtccctgctgcggcgacatcttccgtctctgcgggtgcgggtcgtcaac
gtcgtggacttgatgcggttgcagtcggcgacggagcacccgcacggcatgaccgatcgg
gagtacgacacgttgttcaccgctgatcggccggtgatcttcgcgtatcacgggtacccg
tggctgatccaccgtttgacgtaccgccgcaacggccacgacaacctccacgtgcgcggg
tacaaggaggaggggacgaccacgacgccgttcgacatgctggtgctcaacgacatggac
cggttccagctggtcaccgacgtcatcgaccgggtgccggggttgggtcgtcgtgccgcc
ggggtgcggcagtcgatgcaggacaaccggacccggcaccgctactgggtgcggcagcac
ggtgaggatctgccggaggtgcgtgactgggaatggtctgatgggcggacggggtga

DBGET integrated database retrieval system