KEGG   Stackebrandtia nassauensis: Snas_3362Help
Entry
Snas_3362         CDS       T01194                                 

Definition
glucan endo-1,6-beta-glucosidase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sna  Stackebrandtia nassauensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Snas_3362
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Snas_3362
Enzymes [BR:sna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Snas_3362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3561796..3563289)
Genome map
AA seq 497 aa AA seqDB search
MALSKNPAAWLTVLIALVLVPLVPSSAQATWPRTTVSSWITTPDRARLLDPGPSPVFRRH
GSSNQTTITVDERQRFQSIDGFGASLTDSSASLLYSLSESQRDDVMASLFDRTDGIGMSF
LRQPIGSSDFVDGPHYTYNDLPDGETDFDMSRFSIAHDEVRILPLLRQARALNPSLKVMA
TPWGQPAWMKENNSTIGGRLKDDPDIFAAYALYLLRFVEAYEDAGVPIYALTVQNEPQHG
DPDGYPGTDMPVEHQAAIIEKLGPMLDDAGYGHVKILSFDHNWALHPDDPGGNPRYPYDV
LKSQAVTWIDGTAYHCYAGSPDAQTALHDSFPDKDIWFTECSGWHGNDDSPAKYFSDTLR
WHAQNVTIGTTRNWARAAINWNLALNSQGGPANGGCGNSTTGKCTGVVHIDGTTVTRNAE
YYNLGHMTKYVRPGAVRIGSDNAGDIHNVAFKNPGGTIVLVATNIGGSTQTFTVSWSGRS
IEYTLDSGAVATLTWRA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtggctctatccaagaaccccgccgcttggctgaccgtcctaatcgcactggtgctcgtt
ccgctcgtgccgagttccgcgcaggcgacctggccgcgcaccacggtctcgtcctggatc
accacgcccgaccgggcccgactgttggatcccggacccagcccggtgttccggcgccac
ggcagctcgaaccaaacgacgatcactgtcgatgagcgccaacgcttccagagcatcgac
ggtttcggcgcgtcgttgacggactcgtcggcgtcgctgctgtacagcctctccgagtcg
cagcgcgacgacgtgatggcgtcgctgttcgaccggaccgacggcatcggaatgagcttc
ctgcgccagccgatcggctcctccgacttcgtcgacggcccgcactacacctacaacgac
ctgcccgacggcgaaaccgacttcgacatgtcgcgattcagcatcgcgcacgacgaagtc
cggatcctgccgctgctgcggcaagctcgtgccctgaacccgagcttgaaagtgatggcc
acaccgtggggccaaccggcctggatgaaggagaacaactccaccatcggcggacggctc
aaggacgaccctgacatcttcgccgcgtacgcgctgtacctgctgcggttcgtcgaagcc
tacgaggacgccggagttcccatctacgcgctgactgtccaaaacgaaccccaacacggc
gaccctgacggataccccggtaccgacatgcccgtggaacaccaggccgcgatcatcgag
aagctgggcccgatgctcgacgacgccgggtacgggcacgtcaagatcctgtcgttcgac
cacaactgggcgctgcaccctgacgatcctgggggcaatcctcgctacccgtacgacgtc
ttgaagagccaggccgtgacgtggatcgacggcaccgcgtatcactgttatgcgggcagt
cccgatgcccaaacggcgctgcatgattcgttccccgacaaggacatctggttcaccgaa
tgctcgggttggcacgggaacgacgacagtcccgcgaagtacttttcggacactctgcgc
tggcatgcccagaacgtcacgatcgggacgacccgcaactgggctcgtgcggcgatcaac
tggaacctggcgctcaactcccagggtggtccggcgaacggcggctgcggcaacagcacc
acggggaagtgcaccggggtggttcatatcgacggcaccaccgtcacgcgaaacgccgag
tactacaaccttgggcacatgacgaagtacgtccgacccggggcggtgcgtatcggcagc
gacaacgccggtgacatccacaatgtggcgttcaagaacccgggcggcaccatcgttctg
gtcgccaccaacatcggcggctctacgcagaccttcacggtgagctggtccggccggagc
atcgagtacacactcgacagcggagctgtcgccacactgacctggcgagcgtaa

DBGET integrated database retrieval system