KEGG   Stackebrandtia nassauensis: Snas_3468Help
Entry
Snas_3468         CDS       T01194                                 

Definition
(GenBank) Dihydrolipoyllysine-residue(2-methylpropanoyl) transferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00010  Glycolysis / Gluconeogenesis
sna00020  Citrate cycle (TCA cycle)
sna00620  Pyruvate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
Module
sna_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_3468
   00020 Citrate cycle (TCA cycle)
    Snas_3468
   00620 Pyruvate metabolism
    Snas_3468
Enzymes [BR:sna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Snas_3468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADD43132
JGI: Snas_3468
UniProt: D3PVL8
Position
3668871..3670091
Genome map
AA seq 406 aa AA seqDB search
MPSLGADMDAGTLTEWLVAPGDHVSKGDIVAVVETAKADMEVECFDAGVIGELLVHPGAR
VPVGTVLATIVTDDGGSPGEPAAAPAIEPAPPRADAPPEPPRVSPLVRHLARENHVDLAK
VPATGPDGTVTRADLDRVLHRRRISPLARRLATELKVDLARIDADGPIHARHVREAATHR
HPAERSTSAAREATARLMARSKREIPHYYLAATIDLGPAVDWLTDLNRRLPVSQRVLPAA
LLLVATARAAATVKDLNGHWIDDRFQAADRIRLGLAVSVRGGGLVVPGIDDAAALSVPEM
MDRVRDLATRARTGQLRAGELADPSITVSNLGDTGVDSVLGVIYPPQVALVGFGAITERP
WAVNGLLGVRPVVTASLSADHRVTDGAVGARFLNHIDRLLREPEEL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgctgggcgcggacatggacgcgggaaccctcaccgaatggctcgtcgctccc
ggcgaccacgtgtccaaaggtgacatcgtcgcggtcgtggagaccgccaaggcggacatg
gaggtcgagtgcttcgatgccggggtgatcggcgaactgctggtgcacccgggcgcccgg
gtgccggtcggcaccgtcctggccaccatcgtcaccgacgacggcggctcgcccggcgaa
ccggcagccgcccccgcgatcgaaccggccccgccgcgtgctgatgccccacccgaaccg
ccgagggtgtcacccctggtgcggcacctcgcccgtgagaaccacgtggacctcgccaag
gtcccggccaccggacccgacggcacggtcacccgcgccgacctggaccgggtactgcac
cgtcgccggatctcgccactggctcggcgcctggccaccgaactgaaggtcgacctggcg
cgcatcgacgccgacgggccgatccacgcccggcacgtgcgcgaagccgcgacccaccgc
cacccggccgagcgctccacgtccgcggcccgcgaggccacggcccggttgatggcccgc
tccaaacgcgagatcccgcactactacctggccgccaccatcgacctgggcccggccgtg
gactggctcaccgatctcaaccggagactgccggtgagtcagcgtgtcctgcccgccgcg
ctgctgctggtcgccaccgctcgcgccgcggccaccgtcaaagatctcaatggacactgg
atcgacgaccggttccaggcggccgaccgtatccggctgggcctggccgtgtcggtgcgc
ggcggcggcctggtggtacccggaatcgacgatgccgccgccctgagcgtgccggagatg
atggaccgcgtccgcgacctcgccacccgggcccggaccggtcaactgcgtgccggtgag
ctggccgatcccagcatcaccgtctccaacctgggtgacaccggagtcgacagcgtcctc
ggggtgatctacccgccccaggtggcgctggtcgggttcggcgcgatcaccgagcgcccc
tgggccgtgaacggtcttctcggcgtgcgtccggtggtcaccgcgagcctgtcggccgat
caccgggtgaccgacggcgccgtgggcgccagattcctcaaccacatcgaccggttgcta
cgcgaaccggaggagctatga

DBGET integrated database retrieval system