KEGG   Stackebrandtia nassauensis: Snas_3468Help
Entry
Snas_3468         CDS       T01194                                 

Definition
Dihydrolipoyllysine-residue(2-methylpropanoyl) transferase (EC:2.3.1.168)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sna  Stackebrandtia nassauensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:sna01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sna00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sna00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sna00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3668871..3670091
Genome map
AA seq 406 aa AA seqDB search
MPSLGADMDAGTLTEWLVAPGDHVSKGDIVAVVETAKADMEVECFDAGVIGELLVHPGAR
VPVGTVLATIVTDDGGSPGEPAAAPAIEPAPPRADAPPEPPRVSPLVRHLARENHVDLAK
VPATGPDGTVTRADLDRVLHRRRISPLARRLATELKVDLARIDADGPIHARHVREAATHR
HPAERSTSAAREATARLMARSKREIPHYYLAATIDLGPAVDWLTDLNRRLPVSQRVLPAA
LLLVATARAAATVKDLNGHWIDDRFQAADRIRLGLAVSVRGGGLVVPGIDDAAALSVPEM
MDRVRDLATRARTGQLRAGELADPSITVSNLGDTGVDSVLGVIYPPQVALVGFGAITERP
WAVNGLLGVRPVVTASLSADHRVTDGAVGARFLNHIDRLLREPEEL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgctgggcgcggacatggacgcgggaaccctcaccgaatggctcgtcgctccc
ggcgaccacgtgtccaaaggtgacatcgtcgcggtcgtggagaccgccaaggcggacatg
gaggtcgagtgcttcgatgccggggtgatcggcgaactgctggtgcacccgggcgcccgg
gtgccggtcggcaccgtcctggccaccatcgtcaccgacgacggcggctcgcccggcgaa
ccggcagccgcccccgcgatcgaaccggccccgccgcgtgctgatgccccacccgaaccg
ccgagggtgtcacccctggtgcggcacctcgcccgtgagaaccacgtggacctcgccaag
gtcccggccaccggacccgacggcacggtcacccgcgccgacctggaccgggtactgcac
cgtcgccggatctcgccactggctcggcgcctggccaccgaactgaaggtcgacctggcg
cgcatcgacgccgacgggccgatccacgcccggcacgtgcgcgaagccgcgacccaccgc
cacccggccgagcgctccacgtccgcggcccgcgaggccacggcccggttgatggcccgc
tccaaacgcgagatcccgcactactacctggccgccaccatcgacctgggcccggccgtg
gactggctcaccgatctcaaccggagactgccggtgagtcagcgtgtcctgcccgccgcg
ctgctgctggtcgccaccgctcgcgccgcggccaccgtcaaagatctcaatggacactgg
atcgacgaccggttccaggcggccgaccgtatccggctgggcctggccgtgtcggtgcgc
ggcggcggcctggtggtacccggaatcgacgatgccgccgccctgagcgtgccggagatg
atggaccgcgtccgcgacctcgccacccgggcccggaccggtcaactgcgtgccggtgag
ctggccgatcccagcatcaccgtctccaacctgggtgacaccggagtcgacagcgtcctc
ggggtgatctacccgccccaggtggcgctggtcgggttcggcgcgatcaccgagcgcccc
tgggccgtgaacggtcttctcggcgtgcgtccggtggtcaccgcgagcctgtcggccgat
caccgggtgaccgacggcgccgtgggcgccagattcctcaaccacatcgaccggttgcta
cgcgaaccggaggagctatga

DBGET integrated database retrieval system