KEGG   Stackebrandtia nassauensis: Snas_3547Help
Entry
Snas_3547         CDS       T01194                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sna00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sna00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sna02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3755064..3756650
Genome map
AA seq 528 aa AA seqDB search
MNGGIDRRRLLGYGGAATAAVMLGTGVFGAEAAQAYSPKGENLFTLGVASGDPAPDGFVL
WTRLAPDALAEDGFGGMPDKRVKVDYEVATDERFRHVVKRGSAVASRELGHSVHPEIHGL
QPGREYFYRFRAGGQISPVGRTRTMPSRSSTPRSLDFVFASCQAWQDGYFTAYDHIVEDD
PELLVFLGDYIYEYEILDNNKRGVDVDPKFGTECFDLARYRLQYSFYKSEAPLQRAHAAM
PWIVTLDDHEVVNDWAADEVAYGRHPNPDPEEFAARKTAAFQAYYENLPLRIDQRPSGPS
IQLYRRLSYGRLATFSMIDCRSYRDVQPCRKLGPAECEERYDPNRTMLGTEQREWLIDGF
ADDESRWHILGNQDPITETDWDATEGKNVWLDPWDGYTAERATILEAAQHPTRNLVVLTG
DRHQNYACDLKQDFTKDDSPVVATEFVTTSLTSGGNGADMDDLGRTFLSANSHMKFYNNQ
RGYVRVNVDKHRWQSDFRVLPYVTDEGAPVSTRASYVVEDGKPGPQAD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
ttgaacggtggcattgacagacggcggcttctcggttacggcggagccgccaccgcggcg
gtgatgctcggcaccggcgtgtttggcgccgaggcggcgcaggcgtacagccccaagggc
gagaacctgttcacgctcggggtcgcgtcgggagaccccgccccggacgggttcgtgctg
tggacccgcctggcgcccgacgcgctggccgaggatggcttcggcggcatgcccgacaag
cgggtcaaagtggactacgaggtcgccaccgacgaacggttccgccacgtggtgaagcgc
ggcagtgccgtggcctcccgggagctgggccactccgtgcatccggagatccatggcctg
caaccgggccgcgagtacttctaccgctttcgggcgggcgggcagatctcgccggtcggt
cgcacccggaccatgccgtcgcgttcgtccacgccccgcagtctcgacttcgtgttcgcg
tcgtgccaggcgtggcaggacgggtacttcaccgcgtacgaccacatcgtcgaggacgac
cccgagttgctggtgttcctgggcgactacatctacgagtacgagatcctcgacaacaac
aagcgtggtgtcgacgtcgatcccaagttcggcaccgagtgcttcgacctggctcgctac
cgccttcagtactcgttctacaagagcgaggcgcccctgcagcgggcacatgccgcgatg
ccgtggatcgtcactctcgacgatcacgaggtggtcaacgactgggccgccgatgaggtc
gcctacggccgccaccccaacccggaccctgaggagttcgccgcgcggaagacggcggcg
ttccaggcgtactacgagaacctgccgctgcgcatcgaccagcggccgtcgggaccgtcg
atccagctgtaccgtcgcctgtcctacggcaggctcgccaccttcagcatgatcgactgc
cgcagctaccgtgacgtccagccgtgccgcaaactcgggcccgccgagtgcgaggagcgc
tacgacccgaaccgcaccatgctcggcaccgaacagcgcgaatggctcatcgacgggttc
gccgacgacgagagccgctggcacatcctcggcaaccaggacccgatcaccgaaaccgac
tgggacgccaccgagggaaagaacgtgtggcttgatccgtgggacgggtacaccgccgag
cgcgccacgatcctggaagcggcccagcaccccacgcgcaacctggtcgtgctcaccggt
gaccggcatcagaactacgcctgcgacctcaaacaggacttcaccaaggacgacagcccg
gtcgtggccaccgaattcgtcaccacctcgctgaccagcggcggtaacggggcggacatg
gacgacctgggccggacgttcctgagcgccaactcccacatgaagttctacaacaaccag
cgcggatacgtgcgggtcaacgtggacaaacaccgctggcaaagtgacttccgcgtcctg
ccgtacgtgaccgacgaaggcgcaccggtcagcacccgcgccagctacgtcgtggaggac
ggcaagcccggtccccaggccgactag

DBGET integrated database retrieval system