KEGG   Stackebrandtia nassauensis: Snas_3593Help
Entry
Snas_3593         CDS       T01194                                 

Definition
hypothetical protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sna00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3817563..3819284)
Genome map
AA seq 573 aa AA seqDB search
MERMATALACAAIDRHLAGVLLFNLDPGRIGALGRWLAALLGSQTRTVLAGAATHDEDLW
TRFSLSGSQVSITPGALFDQTVVLVPDLTQLSDAGARAAIATIGADVAHIERDGHQSIQV
PKARWLVGCRREGAGELSRHLLDRFALRVDAADVPGELDPPPRSWRDAVERAAHATPLPM
STRVLGYVMELFTAADAGARRPVAVARLARAIARLDGDETVSVRHVDLATEHLGIPRHHR
LSVVDDASPLSRNDAAGPAPNRTEEAIQAPEGPVPQYLAAGAGFEAPSAVHTSLVAVPYP
EDEPMTRSRLGSVNLDHTSPQWSNVAAHGRPWGTVPAHDLTDLSITASLLEACKLQVMRC
PGHHGSAHRLHVTAADLRRHKRTIQPTDLLVLLVDHTCGGANWNLPAALGAHIAWAYEQR
AHIRVVELGDADSADELSARQFVVRNALDRRLHRVLSRRPGRATPLAHGIELAGRVLRRF
AGSDRSVARDTRFVLVTDGRGNVPLSASLTGQVDFPVARRGVEDSLYAARQIRTLPRTQT
IVVCPGSHRTSPVVTELAQVLGADILTGDGDNG
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggaacggatggccaccgcgctggcgtgcgccgcgatcgatcgacacctggcaggggtg
ctgctgttcaatctggatccgggacggatcggtgcgctggggcggtggctcgcagcgttg
ctcggcagccagacccgcacggtgctggctggcgcggccacccacgatgaagacctgtgg
acccggttcagcctcagcggttcacaggtgtccatcacaccgggcgcgctgttcgaccag
acggtggtgctggttcccgatctgacacagctgagcgatgccggcgcccgtgcggccatc
gccaccatcggtgccgacgtcgcacacatcgaacgtgatgggcaccagtcgatccaggta
ccgaaagcccgctggctggtgggttgccgccgagagggcgcgggggagttgtcgcggcat
ctgctcgaccggttcgcattgcgcgtcgacgccgccgacgtgcccggcgaactcgacccg
ccaccacgatcgtggcgcgacgccgtcgaacgcgcagcgcacgcgacaccactgccgatg
tcgacgcgagtgctcggctatgtcatggaactgttcaccgccgccgacgccggtgcgcgc
cgtcccgtggcggtcgcccgcctcgcccgcgcgatcgcccgcctggacggcgacgagacg
gtttcggtccggcatgtggacctggccaccgagcatttgggtataccgcgccaccaccgg
ttgtccgtagtggacgatgcttcgccgctgtcgcggaatgatgcggctggcccggccccg
aaccggactgaagaggccatccaggctcccgaggggccggtgccgcagtacctggcggcc
ggagccggtttcgaagccccgtcggccgtccacacgtcgctggtggccgtgccgtatccc
gaggatgagccgatgacacggtcacggctcggttcggtgaacctggaccacacgtcgcca
caatggagcaacgtcgccgcacacggccgaccgtggggaacggttccggcacacgacctg
acggacctgtcgatcaccgccagcctcctggaagcctgcaaactacaggtcatgcgctgc
cccgggcaccacggctcggcacaccggctgcacgtgaccgccgccgacctgcgtcggcac
aaacggaccattcagcccaccgacctgctggtgctgctggtggatcacacctgtggcggc
gccaactggaacctgcccgcggcgctgggggcccacatcgcctgggcctacgagcaacgc
gcccacatccgcgtcgtcgaattgggcgacgccgacagcgccgacgagctgtccgcccgg
cagttcgtcgtccgcaatgccctggaccggcggctccacagggtgctgtcacggcggccc
ggacgggctactccgctggcacacgggatcgagttggcgggccgcgtcctgcgccgattc
gccggatcggaccgatccgtggcccgtgacacccggttcgtcctcgtcaccgacgggcgg
ggaaacgtaccactgtcggccagcctcaccggccaggtcgacttcccggtggcccgtcgc
ggcgtcgaggacagcctctacgccgcccgccagatcaggactctgccccgaacccagacc
attgtggtgtgtccgggcagccaccggacgagccccgttgtaactgaactggcccaggtg
ctcggtgccgacatcctgaccggtgacggtgacaatggctga

DBGET integrated database retrieval system