KEGG   Stackebrandtia nassauensis: Snas_3594Help
Entry
Snas_3594         CDS       T01194                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Snas_3594
Enzymes [BR:sna01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Snas_3594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3819288..3820220)
Genome map
AA seq 310 aa AA seqDB search
MTDDIQVLPYSYVVGQDALKHALEISYVSRGSGGVLIAGERGTAKSTTVRAFTRMVNDRL
PVTLPINATDDRVLGGWRIEELMRGEARPQPGLLETANDGVLYIDEVNLLDDHLVNVILD
VASTGILVVQREGRDEQIPVSFTLVGTMNPEEGGLRPQLLDRFGMAVPVSTETDVGRRAE
ILSTVLRFDVEGALPSSTWLSQGTRNDQARREALNAARDRVSDSVVSDKIVDLCAQVATE
FKATGHRSEIVMVNAARAETALDGRTAVEPRDVAAVAPFALLHRRPEAAFAEDLSWTAAD
QKLLDALTTE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgacatccaggtacttccatactcctatgtagtagggcaggacgcgctcaag
cacgcgctggaaatcagctacgtcagccgaggttctgggggcgttttgatcgccggcgaa
cgcggcaccgcgaagtcgaccaccgtccgggcgttcacccgcatggtgaacgaccgactg
ccggtgaccctgcccatcaacgccaccgacgatcgggtgctgggcggctggcgcatcgag
gagctgatgcggggcgaggcacggccgcaaccgggtctgctggagaccgccaatgacggc
gtactgtacatcgacgaggtcaaccttctagacgatcacctggtgaacgtgatcctggac
gtcgcatcgaccgggatcctggtggtgcagcgggaaggccgcgacgagcagatcccggtg
tcgttcacgctcgtgggcacgatgaaccccgaggagggcgggctgcgaccgcagctgctc
gaccgcttcgggatggcggtaccagtgagcaccgagacggacgttggacgccgcgcggag
attctgtctacagtgctgcgatttgatgtggagggtgccctgccgtcctcgacctggctg
agccagggcaccaggaacgaccaggcccggcgcgaagcactcaacgcggcccgcgatcgc
gtgagcgacagcgtggtcagcgacaagatagtggacttgtgcgcgcaggtggccaccgag
ttcaaggccaccgggcaccgcagcgagatcgtcatggtcaacgcggcccgcgccgagacg
gccctcgacggacgaactgcggtggaaccacgggacgtggcggcggtggctccgttcgcg
ctgttgcaccgccgtcccgaggccgccttcgccgaagacctctcgtggactgcggcggat
cagaagctgcttgatgccctgaccacggagtga

DBGET integrated database retrieval system