KEGG   Stackebrandtia nassauensis: Snas_3827Help
Entry
Snas_3827         CDS       T01194                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sna  Stackebrandtia nassauensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sna00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Snas_3827
Enzymes [BR:sna01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Snas_3827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4085002..4085604)
Genome map
AA seq 200 aa AA seqDB search
MIASLTGTVTHVSTSTATITVGGVGMSVRATPGTLANLRVGGESTLYTTLVVREDSLTLY
GFEAPDERDLFELLQTASGVGPRLAQAALAVHPPATVRHAIASGDTATLTRIPGVGKKGA
ERLVLELKDKIGALPGSMATEPKAGRPVSWRDQVQQGLMSLGWSAKDANGAITKLDSQVD
GEAVDIQGLLKQAIRLLGTK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgattgccagtctcaccgggacggtgacccacgtcagcacctcgaccgcgaccatcacg
gtcggcggcgtgggcatgagcgtgcgggccacccccggcaccctggccaacctgcgcgtc
ggcggcgagtccactctgtacaccaccctggtcgtgcgcgaggactcgctgaccctgtac
ggcttcgaggcacccgacgagcgggacctgttcgagctgttgcagaccgccagcggcgtc
ggcccccggctggcacaggccgcgctggcggtgcacccgcccgccaccgtccggcacgcc
atcgcctccggcgacaccgcgaccctgacccgcatccccggcgtcggcaagaagggcgcc
gaacgcctggtcctggaactgaaggacaagatcggcgcgctgcccggctcgatggccacc
gagcccaaggccggacggccggtgtcgtggcgcgaccaggtgcagcagggcctgatgagc
ctgggctggtcggccaaggacgccaacggcgccatcaccaagctcgactcccaggtcgac
ggtgaggctgtcgacatacagggcctgctcaaacaggccatccggctgttggggacgaag
tga

DBGET integrated database retrieval system