KEGG   Stackebrandtia nassauensis: Snas_3928Help
Entry
Snas_3928         CDS       T01194                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00860  Porphyrin and chlorophyll metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Snas_3928
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Snas_3928
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Snas_3928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 DAO FAD_binding_2 Pyr_redox NAD_binding_9 HI0933_like Thi4 Trp_halogenase AlaDh_PNT_C FAD_oxidored Lycopene_cycl FAD_binding_3 MCRA GIDA
Motif
Other DBs
NCBI-ProteinID: ADD43583
JGI: Snas_3928
UniProt: D3PZP6
Position
complement(4193710..4195143)
Genome map
AA seq 477 aa AA seqDB search
MTPRHVVVVGGGIAGLAAAQRLRELGGPELRITVVEQAPRLGGKIRTGELAGVPVETGAE
TFLVRRPEAKALAETVGLGARLVHPAAAPAALVIDDELRDLPRRTVMGVPARADDVAGVL
SPAGRERLEQEPVGDGPILGDEDVTVGALVRKHFGDEIVDRLVDPLLGGVYSGRADGLSV
DVTVPQLAAAARRHDTLAGAVADCLPPVAGAPSAGSAAFGAAASGSASSVPPVFGSVEGG
LSRLVEATATAAAAEIVLGKPVRELRRTPEGWRCVAGDTRTPRVIECDALVLATPARPAA
RLLADVEAAAAAELGVLDYASIALVTLALGGVELPQRSGFLVPATEGRTIKAATFFTRKW
PHLARPGLSLVRVSLGRYGEEQVLQRDDAELADIAHAELSAVLGMELPRPRAVAVDRWGG
GLPQYSAGHADRIRRARAALAEHPIALAGALADGVGIPACVASGRAAAEAVHATLTT
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgcggcacgtcgtcgtggtcggtggcggtatcgccgggctcgcggcggcgcag
cggttgcgggagctgggtggtccggagctgcggatcaccgtggtggagcaggcgcctcgg
ctgggcggcaagatccgtaccggtgagctggcgggggtgccggtggagaccggtgccgag
acgttcctggtgcggcggcccgaggccaaggcgttggctgagaccgtcgggttgggggcg
cggctggttcatccggcggcggctccggcggcattggtcatcgatgacgagctgcgcgat
ctgccgcgtcgtaccgtcatgggggtcccggcgcgggccgacgatgtggcgggtgtgctg
agcccggcgggccgtgaacggttggagcaagaaccggtgggggacgggccgatcctcggc
gatgaggacgtgaccgtcggagcgttggtgcgtaagcatttcggcgacgagatcgtcgat
cggctcgtcgatccgctgctgggtggtgtctactcgggacgggccgatggactgtcggtg
gacgtgacggtgccgcagttggcggctgccgctcgacggcacgacaccttggccggggcg
gtggcggattgtctgccgcccgtagcgggtgcgccatcggcgggttcggccgcgttcggg
gctgccgcttcgggttcggcttcgtcggtcccgccagtcttcggttccgtcgagggtgga
ctgtcgcggttggtcgaggccacggccaccgccgccgcagccgagatcgtgttgggcaag
ccggtgcgggaactgcggcgcacgcccgaggggtggcgttgcgtcgccggtgacacccgc
acgccgcgcgtcatcgagtgcgacgcgttggtgttggccacgcccgctcgtccggcggcg
cggttgctggccgatgtggaggctgccgccgccgctgagctgggtgtgctcgactacgcc
agcatcgcgttggtgacgttggcgttgggtggggtggaactgccgcagcggtcggggttc
ctggtgcccgcgacggagggccgcaccatcaaggccgcgacgttcttcacgcggaagtgg
ccccatctggcgcggcccgggctcagcctcgtacgggtgtcgttgggccggtacggcgag
gagcaggtcctgcagcgcgacgacgccgaactggccgacatcgcgcatgccgaactgtcg
gctgtgctcggcatggagttgccacggccgcgagcggtcgccgtggatcgctggggtggc
gggttgccgcagtactcggcggggcacgccgaccggatccggcgggcccgggcggcgctg
gccgagcatccgatcgcgttggccggggcgttggccgacggggtggggattccggcctgt
gtcgcgtcgggacgggccgccgccgaggccgtccacgctacacttacgacgtaa

DBGET integrated database retrieval system