KEGG   Stackebrandtia nassauensis: Snas_4200Help
Entry
Snas_4200         CDS       T01194                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00020  Citrate cycle (TCA cycle)
sna00310  Lysine degradation
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
Module
sna_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sna_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Snas_4200
  Amino acid metabolism
   00310 Lysine degradation
    Snas_4200
Enzymes [BR:sna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Snas_4200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADD43850
JGI: Snas_4200
UniProt: D3Q2B7
Position
4498534..4500285
Genome map
AA seq 583 aa AA seqDB search
MPVSVTMPALGESVTEGTITQWLKKEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLTRIV
AAEDETVEVGAELAVIGESGDAPAQSSEPEGGQQPQAEEPEEEPLPPQSQEESPAPADQP
PANQPQASAPAASGSGTEVPMPALGESVTEGTITRWLKAVGDTVEVDEPLVEVSTDKVDT
EIPSPVAGTLLEIKVAEDETADVGAALAVVGESGGAAPAAESKPAPAPEAAKPAPAPESK
PAPAPQAPAPQAAPAAESKPAAAPAAPAADTSGVYVTPLVRKLAAEKDVDLSKVTGTGVG
GRIRKQDVLAAAEAAAPAPAPEPAKAAAAAPAAKSAAPLEPSPLRGRTEKMSRLRKLIAK
NTFDALHTQAQLTTVIEVDVTKIAHLRAATKDAFLKRHGVKLSFLPFFAMAAVEALQVYP
QVNASIDMEAGTITYPEAENLGMAVDTDKGLIAPVIHNAGDLNLGGLARRIADLAQRTRD
NKLTPDDIAGGTFTLTNTGSRGALFDTPIVNAPQSAMLGTGAVVKRPVVVNDPELGEVIA
PRSMMYLALSYDHRIIDGADAARYLTAVKQRLEEGNFEAQLGL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatcggtaaccatgcccgccctcggcgaaagcgtcacggagggcaccatcacg
caatggctgaagaaggaaggcgacaccgtcgaggtcgacgagccgctgctggaggtgtcg
accgacaaggtggacaccgagatcccgtccccggccgcgggtgtgctcacccgcatcgtg
gccgccgaggatgagaccgtcgaggtcggcgccgagctggccgtgatcggcgagagcggc
gacgccccggcgcagtcctccgaacccgagggcggccagcagccgcaggccgaggagccg
gaggaggagccgctgccgccgcagtcgcaggaggagtccccggccccggccgaccagccg
cccgcgaaccagccgcaggcgtcggcgcccgccgccagcggttccggtaccgaggtgccg
atgcccgcgctgggcgagtcggtcaccgagggcaccatcacccgctggctcaaggccgtc
ggcgacaccgtcgaggtcgacgagccgctggtcgaggtgtcgaccgacaaggtggacacc
gagatcccgtcgccggtggcgggcacgctgctggagatcaaggtcgccgaggacgagacc
gccgacgtcggcgccgcgctggccgtggtgggcgagtcgggcggggcggctccggccgcc
gagtccaagcccgctcccgctcccgaggccgccaaaccggctccggccccggagtcgaaa
ccagcccccgcgccgcaggctccggccccgcaggccgctccggctgccgagtcgaagccc
gccgcggccccggccgctccggccgccgacacctccggcgtgtacgtgacgccgctggtg
cgcaagctggccgccgagaaggacgtggacctgtccaaggtcaccggtaccggtgtcggc
ggacgcatccgcaagcaggacgtgctggccgcggccgaggccgccgctccggcacccgcg
cccgagcccgccaaggcggccgcggcggcaccggcggccaagtccgccgcgccactggag
cccagcccgctgcggggccgcaccgagaagatgtcgcgactgcgcaagctgatcgccaag
aacaccttcgacgcgctgcacacccaggcgcagctgacgacggtgatcgaagtggacgtc
acgaagatcgcgcacctgcgcgccgccaccaaggacgcgttcctcaagcggcacggcgtg
aagctgtccttcctgccgttcttcgcgatggccgccgtcgaggcgctccaggtgtacccg
caggtcaacgccagcatcgacatggaagccgggaccatcacctaccccgaggccgagaac
ctcggcatggcggtggacaccgacaagggcctgatcgccccggtcatccacaatgccggt
gacctgaacctgggtgggctggcccggcgcatcgccgacctggcgcagcgcacccgggac
aacaagctgacgccggacgacatcgcgggcggcacgttcacgctgaccaacaccggttcg
cggggcgcgctgttcgacacgccgatcgtcaacgcgccgcagtcggcgatgctgggcacc
ggtgccgtcgtcaagcgtccggtcgtggtcaacgacccggagctcggcgaggtcatcgcg
ccccggtccatgatgtacctggcgttgtcctacgaccaccgcatcatcgacggtgccgac
gccgcgcgctacctgaccgcggtcaagcagcgcctggaagagggcaacttcgaggcccag
ctgggtctgtaa

DBGET integrated database retrieval system