KEGG   Stackebrandtia nassauensis: Snas_4200Help
Entry
Snas_4200         CDS       T01194                                 

Definition
2-oxoglutarate dehydrogenase E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sna  Stackebrandtia nassauensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Snas_4200
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Snas_4200
  Amino acid metabolism
   00310 Lysine degradation
    Snas_4200
Enzymes [BR:sna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Snas_4200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4498534..4500285
Genome map
AA seq 583 aa AA seqDB search
MPVSVTMPALGESVTEGTITQWLKKEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLTRIV
AAEDETVEVGAELAVIGESGDAPAQSSEPEGGQQPQAEEPEEEPLPPQSQEESPAPADQP
PANQPQASAPAASGSGTEVPMPALGESVTEGTITRWLKAVGDTVEVDEPLVEVSTDKVDT
EIPSPVAGTLLEIKVAEDETADVGAALAVVGESGGAAPAAESKPAPAPEAAKPAPAPESK
PAPAPQAPAPQAAPAAESKPAAAPAAPAADTSGVYVTPLVRKLAAEKDVDLSKVTGTGVG
GRIRKQDVLAAAEAAAPAPAPEPAKAAAAAPAAKSAAPLEPSPLRGRTEKMSRLRKLIAK
NTFDALHTQAQLTTVIEVDVTKIAHLRAATKDAFLKRHGVKLSFLPFFAMAAVEALQVYP
QVNASIDMEAGTITYPEAENLGMAVDTDKGLIAPVIHNAGDLNLGGLARRIADLAQRTRD
NKLTPDDIAGGTFTLTNTGSRGALFDTPIVNAPQSAMLGTGAVVKRPVVVNDPELGEVIA
PRSMMYLALSYDHRIIDGADAARYLTAVKQRLEEGNFEAQLGL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatcggtaaccatgcccgccctcggcgaaagcgtcacggagggcaccatcacg
caatggctgaagaaggaaggcgacaccgtcgaggtcgacgagccgctgctggaggtgtcg
accgacaaggtggacaccgagatcccgtccccggccgcgggtgtgctcacccgcatcgtg
gccgccgaggatgagaccgtcgaggtcggcgccgagctggccgtgatcggcgagagcggc
gacgccccggcgcagtcctccgaacccgagggcggccagcagccgcaggccgaggagccg
gaggaggagccgctgccgccgcagtcgcaggaggagtccccggccccggccgaccagccg
cccgcgaaccagccgcaggcgtcggcgcccgccgccagcggttccggtaccgaggtgccg
atgcccgcgctgggcgagtcggtcaccgagggcaccatcacccgctggctcaaggccgtc
ggcgacaccgtcgaggtcgacgagccgctggtcgaggtgtcgaccgacaaggtggacacc
gagatcccgtcgccggtggcgggcacgctgctggagatcaaggtcgccgaggacgagacc
gccgacgtcggcgccgcgctggccgtggtgggcgagtcgggcggggcggctccggccgcc
gagtccaagcccgctcccgctcccgaggccgccaaaccggctccggccccggagtcgaaa
ccagcccccgcgccgcaggctccggccccgcaggccgctccggctgccgagtcgaagccc
gccgcggccccggccgctccggccgccgacacctccggcgtgtacgtgacgccgctggtg
cgcaagctggccgccgagaaggacgtggacctgtccaaggtcaccggtaccggtgtcggc
ggacgcatccgcaagcaggacgtgctggccgcggccgaggccgccgctccggcacccgcg
cccgagcccgccaaggcggccgcggcggcaccggcggccaagtccgccgcgccactggag
cccagcccgctgcggggccgcaccgagaagatgtcgcgactgcgcaagctgatcgccaag
aacaccttcgacgcgctgcacacccaggcgcagctgacgacggtgatcgaagtggacgtc
acgaagatcgcgcacctgcgcgccgccaccaaggacgcgttcctcaagcggcacggcgtg
aagctgtccttcctgccgttcttcgcgatggccgccgtcgaggcgctccaggtgtacccg
caggtcaacgccagcatcgacatggaagccgggaccatcacctaccccgaggccgagaac
ctcggcatggcggtggacaccgacaagggcctgatcgccccggtcatccacaatgccggt
gacctgaacctgggtgggctggcccggcgcatcgccgacctggcgcagcgcacccgggac
aacaagctgacgccggacgacatcgcgggcggcacgttcacgctgaccaacaccggttcg
cggggcgcgctgttcgacacgccgatcgtcaacgcgccgcagtcggcgatgctgggcacc
ggtgccgtcgtcaagcgtccggtcgtggtcaacgacccggagctcggcgaggtcatcgcg
ccccggtccatgatgtacctggcgttgtcctacgaccaccgcatcatcgacggtgccgac
gccgcgcgctacctgaccgcggtcaagcagcgcctggaagagggcaacttcgaggcccag
ctgggtctgtaa

DBGET integrated database retrieval system