KEGG   Stackebrandtia nassauensis: Snas_5004Help
Entry
Snas_5004         CDS       T01194                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00620  Pyruvate metabolism
sna00630  Glyoxylate and dicarboxylate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Snas_5004
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_5004
Enzymes [BR:sna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Snas_5004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADD44641
JGI: Snas_5004
UniProt: D3Q9U5
Position
complement(5311293..5312852)
Genome map
AA seq 519 aa AA seqDB search
MGERFAEILSPEALDFLAVLHREFAGRRAELLAARARRQADFDAGAGLDFLAETAAVRDD
PGWRVAEPAPGLVDRRVEITGPTDRKMTVNALNSGAKVWLADLEDANTPLWENVVAGQLN
LRDALDRTIDFDAGGKQYRLKPAGELATIVVRPRGWHLDEKHLLVDGERMSGSLVDFGLY
FFHCARRQLERGHGPYFYLAKLESHLEARLWNDVFVRAQQLVDIPRGTIRATVLIETVTA
AFEMEEILYELRDHSAGLNAGRWDYLFSIIKKFRARGAEFLLPERNAVTMTAPFMRAYTE
LLVRTCHKRGAHAIGGMAAFIPSRRDPQVNATALDKVRADKSRESGDGFDGSWVAHPDLV
PICREEFDKALGENANQLNRLREEVSVTAADLLAVDADPNQITREGLRNDITVALRYLTA
WLGGTGAVAIFNLMEDAATAEISRSQVWQWVHNGVTLADGATVDAELVEGIIAEELKTIA
AEPGVDADRLEQATRLFRAVALDDDYAEFLTLPAYEEMP
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcggttcgccgagatcctcagtccggaggccctggatttcctggccgtcctg
catcgggagttcgccggacggcgcgccgagctgctggccgcgcgagcccggcggcaggcc
gacttcgacgccggggccgggctggacttcctggccgagaccgccgcggtgcgcgacgac
cccggctggcgggtggccgaaccggctcccgggctggtcgaccggcgggtcgagatcacc
gggccgaccgaccgcaagatgaccgtcaacgccctcaactcgggtgccaaggtgtggctg
gccgacctggaggacgcgaacactccactgtgggaaaacgttgtcgcggggcagctgaac
ctgcgcgacgccctggaccggaccatcgacttcgacgccgggggcaagcagtaccggctc
aagcccgccggggagctggcaacgatcgtggtgcggccgcgcggctggcacctggacgag
aagcacctgctggtggacggcgagcggatgtcgggctcgctggtcgacttcgggctgtac
ttcttccactgcgcccgcaggcaactggaacgcgggcacggcccgtacttctacctggcg
aaactggagagccacctcgaggcgcggctgtggaacgacgtgttcgtccgggcgcagcag
cttgtggacattccacgcgggacgatccgcgccaccgtcctcatcgagaccgtcacggcg
gccttcgagatggaggagatcctgtacgagctgcgggaccattcggccgggctcaacgcg
gggcgttgggactacctgttcagcatcatcaagaagttccgggcccggggcgcggagttc
ctgctgccggagcgcaacgcggtgacgatgacggcgccgttcatgcgcgcctacaccgaa
ctgctggtgcgcacctgccacaaacgcggcgcccacgccatcggcgggatggccgcgttc
atccccagccgccgcgatccccaggtcaacgccaccgcgctggacaaggtgcgcgccgac
aagtcgcgcgagtccggcgacggcttcgacggctcctgggtcgcgcaccccgacctggtg
ccgatctgccgggaggagttcgacaaggcgctcggcgagaacgccaaccagctcaaccgg
ttgcgcgaggaggtctcggtgaccgccgccgacctgctcgcggtggacgccgacccgaac
cagatcacccgcgaggggctgcgcaacgacatcaccgtcgcgctgcggtacctgacggcc
tggctgggcggcaccggcgcggtcgcgatcttcaacctgatggaggacgccgccaccgcc
gagatctcgcgctcgcaggtgtggcagtgggtgcacaacggcgtcacgctcgccgacggc
gcgacggtggacgccgagctcgtcgagggcatcatcgccgaggaactcaagaccatcgcc
gccgaacccggtgtcgacgccgaccggctggaacaggcgacgcgacttttccgcgcggtg
gcgctcgacgacgactacgccgagttcctgacgctccccgcgtacgaggagatgccctga

DBGET integrated database retrieval system