KEGG   Stackebrandtia nassauensis: Snas_5017Help
Entry
Snas_5017         CDS       T01194                                 

Definition
glycoside hydrolase family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sna  Stackebrandtia nassauensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Snas_5017
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Snas_5017
Enzymes [BR:sna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Snas_5017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5324329..5325783)
Genome map
AA seq 484 aa AA seqDB search
MPRFELRRAQVLTAVSVLGLVMLVVPGSAPVSGPRVDVWLTTTSDADGRVVDKGLEPQPS
TRFGESDPAAGQLIEVDQGTTYQEFEGGGASFTDTAAWLMRGSGALDEADRDKVMEKLFD
RREGIGLGFLRNPMGASDLARYAYSYDRTCCDLSDFSMDKDADVMALTKQAASINPGITV
KAVPWSSPAWMKDNNDIEHRGWLRHEYYDEYAQYFVKYIQAYAKAGVDIDYVSPQNEPGC
CYGTDYPSMNWNADALRAFTKDHLWPAFRKAGIDTKTLVFDWNWKNFPEMGAEQLADAEL
VDDPLFGGIAWHGYAGDPSTQSEVHKQYPGVKSFNTENSGGGWVDDQQREDMLNLIDYTR
NWGRSWVKWSLAMDQNNGPTSGGCGTCTGLITVHNGGKRHGQVDYTVEYYTMGHLTKFVE
PGAVRVASTDGAVRNVAWRNPDGSTALIAYNDTDKPRTIRIKADGHYASYRLPARASATF
TWGG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgttttgagcttcggcgtgcgcaggtgctgaccgccgtgtcggtcctcgggctg
gtgatgctggtcgttccgggcagcgcgccggtgtccggtccgcgggtggacgtgtggctg
acgacgacgtcagacgcggacggccgggtcgtcgacaagggactggagccgcagccgtcg
acgcggttcggcgagagcgatcccgctgccgggcaactgatcgaggtcgaccagggcacc
acgtaccaggagttcgagggtggcggagcgtccttcaccgacaccgccgcgtggctgatg
cgcggcagcggcgcgctcgacgaggccgaccgcgacaaggtcatggagaagctgttcgac
cgtcgcgaggggatcgggctgggattcctccgcaatcccatgggcgccagcgatctggcg
cgctacgcctactcctacgaccgcacctgttgcgacctgtcggacttctcgatggacaag
gacgccgacgtcatggcgttgacgaagcaggcagcctccatcaatcccgggatcacggtc
aaggcggtgccgtggagttcaccggcctggatgaaggacaacaacgacatcgagcaccgt
ggctggctgcgccacgagtactacgacgagtacgcgcagtacttcgtcaagtacatccag
gcctatgccaaggctggtgtcgacatcgactacgtctcgccgcagaacgagcccggctgc
tgttacggcaccgactatccgtccatgaactggaacgccgatgccttgcgggcgttcacc
aaggaccacctgtggcccgcgttccgtaaggcgggcatcgacaccaagacgctggtgttc
gactggaactggaagaactttcccgagatgggtgccgagcagctggccgacgccgaactg
gtcgacgatccgctgttcggtgggatcgcctggcacggatacgcgggcgatccctcgacg
caaagcgaggtccacaagcaatacccgggcgtgaagtcgttcaacaccgagaactccggc
ggtggctgggtggacgaccagcagcgcgaggacatgctcaacctgatcgactacacccgc
aactggggacgcagctgggtcaagtggagcctggcgatggaccagaacaacggtcccacc
agcggcggctgcggtacctgcaccggactcatcaccgtccacaacggcggcaagcgacac
gggcaggtcgactacacggtcgagtactacacgatggggcacctcaccaagttcgtcgaa
cccggcgcggtgcgcgtcgcctccaccgacggtgcggtccgcaacgtcgcctggcgcaac
cccgacggctccacggcgctgatcgcctacaacgacaccgacaagccgcgaacgatccgg
atcaaggctgacggccactacgcgtcctaccggctgcccgcccgcgcgtcggcgacgttc
acctggggcggctga

DBGET integrated database retrieval system