KEGG   Stackebrandtia nassauensis: Snas_5050Help
Entry
Snas_5050         CDS       T01194                                 

Definition
phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sna  Stackebrandtia nassauensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Snas_5050
   01230 Biosynthesis of amino acids
    Snas_5050
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_5050
   00030 Pentose phosphate pathway
    Snas_5050
   00051 Fructose and mannose metabolism
    Snas_5050
   00052 Galactose metabolism
    Snas_5050
  Energy metabolism
   00680 Methane metabolism
    Snas_5050
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Snas_5050
Enzymes [BR:sna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Snas_5050
Protein phosphatases and associated proteins [BR:sna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Snas_5050
Messenger RNA biogenesis [BR:sna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Snas_5050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5357930..5358955)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGVQQYGHEFVGFRDGWRGPIENKTTPLGVNEVRGI
LPRGGTILRSSRTNPYKVDGGVDKVRSTLTELGVDALIAIGGEDTLGVAKKLTDDGIPVV
GVPKTIDNDLGATDYTFGFDTAVNIASEAIDRLHTTAESHHRCVVVEVMGRHAGWIALHS
GLAGGANAILVPEKRFSVAEVVRFVESRFEIDYSPIVVVAEGAQPAEGEMVTQDKGLDAF
GHVRLGGIGQWLSDEIEKHTGKESRAVVLGHVQRGGTPTAYDRVLATRFGLHAIDAIHEG
DYGKMVALRGTDIVRVELSEATAELKTVPAERLAEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcataggtgtcttgaccggaggcggagactgccccggtctcaatgccgtcatccgg
gctgtggtccgcaagggagtacagcagtacggccacgagttcgtcgggttcagggacggc
tggcgtggccccatcgagaacaagacgaccccgttgggcgtcaacgaggttcgcggcatc
ctgccgcgcggtggaaccatcctgcgctcctcgcgcaccaacccctacaaggtggacggc
ggagtcgacaaggtacggtccacactgaccgaactgggtgtcgacgcgctgatcgccatc
ggcggcgaggacaccctcggcgtggccaagaagctcaccgacgacggcatcccggtcgtg
ggcgttcccaagaccatcgacaacgacctcggcgccaccgactacaccttcggcttcgac
accgccgtcaacatcgcctccgaggccatcgaccggctgcacaccaccgccgagagccac
caccgctgcgtggtcgtcgaggtcatgggccgccacgccggctggatcgcgctccactcc
ggactcgccggtggcgccaacgccatcctggtgcccgagaagcggttcagcgtcgccgag
gtggtgcgcttcgtcgagtcccgcttcgagatcgactactcgccgatcgtcgtggtcgcc
gagggcgcccagcccgccgagggcgagatggtcacccaggacaagggcctggacgccttc
gggcacgtgcgactgggcggcatcggccagtggctgtccgacgagatcgagaagcacacc
ggcaaggagtcccgggccgtggtcctgggtcacgtgcagcgcggcggcacccccaccgcc
tacgaccgggtgctggccacccgcttcgggctgcacgccatcgacgcgatccacgagggc
gactacggcaagatggtcgcgctgcgcggcaccgacatcgtccgggtggaactgtcggag
gccaccgccgagctcaagaccgttccggccgaacggctcgccgaggccgaggtcttcttc
ggttaa

DBGET integrated database retrieval system