KEGG   Stackebrandtia nassauensis: Snas_5339Help
Entry
Snas_5339         CDS       T01194                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00630  Glyoxylate and dicarboxylate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_5339
Enzymes [BR:sna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Snas_5339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3338
Motif
Other DBs
NCBI-ProteinID: ADD44973
JGI: Snas_5339
UniProt: D3PUU9
Position
5668998..5670302
Genome map
AA seq 434 aa AA seqDB search
MSKPTDLRTRTIEQLELDWRTDPRWQNVTRDYTAEQVVKLRGRVQEEHTLARRGAEKLWA
QLTGEAASGGYTNSLGALTGNQAVQQVRAGLRAIYLSGWQVAADANLAGQTYPDQSLYPA
NSVPQVVRRINNALLRADQIEFAEGASSVEDWLVPIVADAEAGFGGPLNAYELMKSMITA
GASGVHWEDQLASEKKCGHLGGKVLIPTSQHVRTLNAARLAADVAGTPTLIVARTDAEAA
TLLTSDIDERDAEFLTGERTSEGYYRVTNGLPACIARAKAYAPYSDLLWMETGTPDLEVA
RQFAEAVKAEFPDQMLAYNCSPSFNWKRHLDNDTIAKFQNELGAMGFTFQFITLAGFHSL
NHSMFDLAHRYAREGMTAYVDLQEREFAAEDAGYTATKHQREVGTGYFDEIATALNPSGS
TLALAGSTESGQFH
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcccacggatctcaggacgcgcaccatcgaacagctggaactcgactggcgc
accgacccgcgctggcagaacgtcacccgcgactacaccgccgagcaggtcgtcaagctg
cgcggccgggtgcaggaggagcacaccttggcccggcgcggcgcggagaagctgtgggcc
cagctgaccggtgaggccgcctcgggcggttacaccaactcgctgggcgcgctgaccgga
aaccaggcggtgcaacaggtccgggccggactgcgcgccatctacctgtcgggctggcag
gtcgccgccgacgccaacctggccggccagacctaccccgaccagtcgctgtacccggcc
aactcggtgccacaggtggtgcggcgcatcaacaacgcgctgctgcgcgccgaccagatc
gagttcgccgagggtgccagcagtgtcgaggactggctggtgccgatcgtcgccgacgcc
gaggccggtttcggcggtccgctcaacgcctacgaacttatgaagagcatgatcaccgcc
ggtgcgtccggggtgcactgggaggaccagctggcgtccgagaagaagtgcggacacctg
ggcggcaaggtcctgatcccgacctcgcagcacgtgcgcaccctcaacgccgcccggctg
gccgccgacgtcgccgggaccccgacgctgatcgtggcccgcaccgacgccgaggccgcc
accctgctcacctccgacatcgacgaacgcgacgccgagttcctgaccggcgagcgcacc
tccgagggctactaccgggtgaccaacgggcttcccgcctgcatcgcccgcgccaaggcc
tacgcgccgtactcggatctgctgtggatggagaccggcacccccgacctggaggtggcg
cggcagttcgccgaggccgtcaaggccgagttcccggaccagatgctggcctacaactgc
tcgccgtccttcaactggaaacggcacctggacaacgacaccatcgccaagttccagaac
gagttgggcgccatgggtttcacgttccagttcatcaccctggcggggttccactcgctc
aaccactccatgttcgacctggcccaccgctacgcccgcgagggcatgacggcctacgtc
gacctgcaagaacgcgaattcgccgccgaagacgccggctacaccgcgaccaagcaccag
cgcgaggtcggcaccggttacttcgacgagatcgccaccgccctcaatccgagcggttcg
acgctggcgctcgccggatccaccgagtccggccaattccactga

DBGET integrated database retrieval system