KEGG   Stackebrandtia nassauensis: Snas_5415Help
Entry
Snas_5415         CDS       T01194                                 

Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sna  Stackebrandtia nassauensis
Brite
Enzymes [BR:sna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Snas_5415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5747385..5748551
Genome map
AA seq 388 aa AA seqDB search
MRNAMVDGIVKWAKLSDATAAAMRKVERHRFVPAATLKEAYTDDTVVTRRDEAGIATSSA
SAPWLQGMMLDQLELRPGMTVLEIGAGTGVNAGYVTELVGPSGHVTTIDIQPDVAEDART
ALALTGATNVEVICGDGEYGYPANAPYDRVIATAGAWDIPEHWVEQLKPDGLMVVPLRMN
GLTRSVAFTRDEHGVWHSKSAVNCGFMPVRGDGEVIETNVQIAKDVVVRIDDGQDLDVEA
LKDAIADSGEVEWTGILIDAPLDLLDFYMADMDGFCRILAPPSIAERGLAEPMNGWGSMG
AATPDAVGYLTKRYGPLHPKLYELGTCAYGPQAQAMVDELTKRVYAWDRARKSVTGVHIE
IHPSGQGDTADALMTIDKRHSRVIVRPA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacgcgatggtcgacggcatcgtcaagtgggcgaaactgtcggacgcgaccgcg
gcggcaatgcgcaaagtcgagcggcaccgattcgttccggccgccacgcttaaagaggcg
tacaccgacgacacggtggtgacgcgtcgcgacgaggccgggatcgccactagctcggcg
tccgcgccgtggctgcaagggatgatgctcgaccagcttgagctgcggcccggcatgacg
gtgctggagatcggggccgggaccggcgtcaacgctggctacgtgaccgaattggtcggg
cccagcggtcacgtcaccaccatcgatattcagcctgatgtcgccgaagacgcccgcacc
gcgctcgcgctcaccggggctacgaacgtcgaggtcatctgcggcgacggcgaatacgga
tatcccgcgaacgctccgtacgaccgggtcatcgctacggccggggcctgggacatcccg
gagcactgggtcgagcagctcaaaccggacgggctcatggtcgtcccgctgcgcatgaac
ggcttgacccgttcggtcgcgttcacccgggacgaacacggcgtgtggcactcgaagagc
gcggtcaactgcgggttcatgccagtcaggggcgacggcgaagtcatcgagaccaacgtc
cagatcgccaaggacgtggtggtccgtatcgatgacggtcaagacctcgacgtcgaagcg
ctcaaggacgcgattgccgattccggggaagtcgaatggacgggcattctcatcgacgcg
ccactagacctgctggacttttacatggccgatatggacggtttctgccgcatcctggcc
ccaccgtccatcgccgagcgcgggctggccgaacccatgaacggctggggaagcatgggc
gccgcgaccccggacgcggtggggtacttgacgaagcgttacggcccgctgcacccgaag
ctgtacgaactgggcacctgcgcgtacgggccgcaagcgcaagccatggtcgatgagctg
accaaacgggtctacgcctgggaccgggcgcgcaagtcggtcaccggcgtccacattgag
atccacccatcggggcaaggcgacaccgccgacgcgctcatgaccatcgacaagcggcac
tcccgggtcatcgtccgacccgcgtaa

DBGET integrated database retrieval system