KEGG   Stackebrandtia nassauensis: Snas_5626Help
Entry
Snas_5626         CDS       T01194                                 

Definition
Arginase/agmatinase/formimino glutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sna01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sna00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5981068..5981880
Genome map
AA seq 270 aa AA seqDB search
MTDRNTNSAWDLIVTPWHLDEHIPAFPIPDTATPVARPALPAGPVPVRMNLLHEATLDVV
TRTDRPLVLSGDCPTARAVLAGMQRRHQDLAVLWLDAHGDFNTPAISTSGYLGGMALAML
TGRTPGLFDDTLGLRPVDEANVVLADARDLDPAEHDALSTSQVHRVPADPAAITTALERL
GGTPVYVHLDIDVIDGAQLPGARFPSGPGPSFAQIEECLTAACATADVVAAYIACAWLPD
HVNDQTTREAITRLTTALGANLTWRQPTDR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcgcaacaccaacagcgcctgggatctgatcgtcacgccctggcatctcgac
gagcacatcccggcctttccgatccccgacaccgcgaccccggtcgctcgcccggctctc
cccgccggtcccgttcccgtccgcatgaacctgctgcatgaggccaccctcgacgtggtg
acgcggaccgacaggcccctggtgttgtccggcgactgccccaccgccagggcggtgctg
gccgggatgcagcgccgtcaccaggacctggccgtgctgtggctggacgcccacggcgac
ttcaacacccccgccatatcgaccagcggctatctcggcggtatggctctggccatgctg
accggccggacacccgggctgttcgacgacacgctcggacttcggccagtcgacgaggcc
aatgtcgtgctcgctgacgccagggatctcgatcccgccgagcacgacgccctgtccacg
agccaggtccaccgtgtacccgccgacccggccgcgatcaccaccgccctcgaaaggctc
ggcggcacaccggtttacgtccacctcgacatcgacgtcattgacggcgcccagctgccc
ggcgcgcgcttcccctccggccccggcccttccttcgcccagatcgaggagtgcctgact
gccgcctgcgccaccgccgacgttgtagccgcctacattgcctgcgcctggctgcccgac
cacgtcaacgaccagaccacacgcgaagcgatcacccggctcacaacagcactcggcgcc
aatctgacatggcgccagccgacagaccgctaa

DBGET integrated database retrieval system