KEGG   Stackebrandtia nassauensis: Snas_5698Help
Entry
Snas_5698         CDS       T01194                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sna  Stackebrandtia nassauensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Snas_5698
Enzymes [BR:sna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Snas_5698
Exosome [BR:sna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Snas_5698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6061318..6062325
Genome map
AA seq 335 aa AA seqDB search
MSETVEPSGFPRIRPRRLRQGSAMRRMVAETRVHPSDLMLPMFVREGLDAPRPIPSMPGV
MQHTRESLRKAVVAAAHAGVGGVMIFGVPAEKDATGSGAIDPDGIGNLALADVTAEVGDS
LVVVSDLCLDEFTDHGHCGVLAADGSVDNDATLERYADMAIAQAQAGAHMLGASGMMDGQ
VGYVRTALDRAGFENTGVFAYAVKYSSAAFGPFREAVESALQGDRRSYQQDPANAREALR
EVELDVAEGADIVMVKPGLPYLDIIRAVSEHVTVPVAAYQVSGEYSMVEAAAANGWIDRE
RMMLESLVSIKRAGASIIATYWAEEAARLLREERF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgttgaaccttcggggtttccgcgaatccggccccggcggctgcgccag
gggtccgcgatgcgccgcatggtcgccgagacccgggtgcacccgtccgacctgatgctg
ccgatgttcgtccgcgagggacttgacgcgccgcgtcccatcccctcgatgccgggcgtc
atgcagcacacccgcgagtcgctgcgcaaggccgtcgtggccgccgcgcacgccggggtc
ggcggcgtcatgatcttcggcgtacccgccgagaaggacgccaccggttcgggcgccatc
gaccccgacggcatcggcaacctcgcgctggccgacgtcaccgccgaggtcggggactcc
ctggtggtcgtgtccgacctgtgcctcgacgagttcaccgaccacggccactgcggcgtg
ctcgccgccgacggcagcgtcgacaacgacgccaccctggagcggtacgccgacatggcc
atcgcccaggcccaggcgggcgcgcacatgctgggcgcttcgggcatgatggacggtcag
gtcggctacgtccgcaccgccctggaccgggccggtttcgagaacacgggcgtgttcgcc
tacgccgtcaagtactcctcggcggccttcgggccgttccgcgaggcggtcgaatcggcg
ctgcagggcgaccgccgcagctaccagcaggaccccgccaacgcccgcgaggcgctgcgc
gaggtcgaactggacgtggccgagggcgccgacatcgtcatggtcaaaccgggactgccc
tatctggacatcatcagggcggtgtccgagcacgtgacggttccggtcgcggcctaccag
gtctccggcgaatactccatggtggaggcagccgctgccaacggctggatcgaccgggaa
cgcatgatgctcgaatcactggtgtcgatcaaacgcgccggggcctcgatcatcgcgacc
tactgggccgaggaagccgcgcggctgctgcgcgaggaacgtttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system