KEGG   Stackebrandtia nassauensis: Snas_5715Help
Entry
Snas_5715         CDS       T01194                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sna00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sna00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sna02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6078984..6080528
Genome map
AA seq 514 aa AA seqDB search
MRGNRFISRRSLFRGGAVLGGAAALGTAGVGFAGPLLNKDRPALTHGVLSGDVTGDTAVI
WTRADRGGQMWVEWSTRPDFADARKVPGPVFRSGNDFTAKTRLRDLPSGKTIHYRAWADD
GATGEPVAGSFRATPVKGQDVKFVWSADIAGQGWGINPDLGGFVLFDDMAATEPDFFLCS
GDFYYGDNPLQESVTLPDGRVWKNVVSDEKSKVAQTLDEFRGQYKYNLTDEPLRKLLAKA
PILSIWDDHEVVNNWYPGEILDDPNYTEKDVDVLAARARKAFTEYMPNPAKPDGEGRIYR
RISHGPLLDVFVLDMRTFKDANTPNNSPDGGTVLGERQLAWLKRELKRSKATWKVIANSL
PLSLIVGDGKENIEGIAQRDNGKPLGRESEIAELLSYIKAKKVTGTVWITADVHYTAAHS
YDPSRAAFTDFEPFWEFVAGPANAGAFGPNKLDTTFGAKVEFSKAPDKDHQNTTPLDGYQ
FFGEVAIDAETKALTVRLVELGGTELYRKELPAA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggaaaccgtttcatcagccgacgatccctgtttcgcggtggagccgtgctcggt
ggcgccgcggcgctgggcaccgccggggtcggcttcgccggtccgctactgaacaaggac
cgtccggcgctgacgcacggggtgctgtcgggggacgtcaccggcgacaccgcggttatc
tggacccgcgccgaccggggcgggcagatgtgggtggaatggtcgacgcgtcccgacttc
gccgacgcgcgcaaggtgcccggcccggtcttccgttccggcaacgacttcaccgccaag
acccgactgcgcgacctgccgtccggcaagaccatccactaccgggcctgggccgacgac
ggcgcgacgggcgaaccggtcgccggatcgtttcgcgccaccccggtcaagggccaggac
gtgaagttcgtgtggtcggccgacatcgccggtcagggctggggcatcaaccccgacctg
ggcggattcgtcctgttcgacgacatggccgccaccgaaccggatttcttcctgtgctcg
ggcgacttctactacggcgacaacccgttgcaggagtccgtgacgctgcccgacggccgg
gtgtggaagaacgtcgtcagcgacgagaagtccaaggtcgcccagaccctcgacgagttc
cgcggccagtacaagtacaacctcaccgacgagccgttgcgcaagctcctggccaaagcc
ccgatcctgtccatctgggacgatcacgaggtcgtcaacaactggtaccccggcgagatc
ctcgacgaccccaactacaccgagaaggacgtcgacgtgctggccgcccgggcccgcaag
gcgttcaccgagtacatgccgaacccggccaaacccgacggtgagggccgcatctaccgc
aggatctcgcacggcccgctgctggacgtgttcgtcctggacatgcgcaccttcaaggac
gccaacacccccaacaactcccccgacggcggcaccgtcctgggcgagagacagctggcc
tggctgaagcgggaactcaagcgctccaaggcgacctggaaggtcatcgccaacagcctg
ccgctgagcctcatcgtcggcgacggcaaggagaacatcgagggcatcgcgcaacgcgac
aacggcaagccactgggccgcgagtccgagatcgccgaactgctgtcgtacatcaaggcc
aagaaggtcaccgggacggtgtggatcaccgccgacgtccactacaccgccgcccactcc
tacgacccgtcccgggccgcgttcaccgacttcgaaccgttctgggagttcgtcgccgga
cccgccaacgccggcgccttcggaccgaacaaactggacaccaccttcggcgcgaaggtc
gagttctccaaggcccccgacaaggaccaccagaacaccaccccgctggacggctaccag
ttcttcggggaggtcgccatcgacgccgagaccaaggcgctgaccgtccggctcgtcgaa
ctcggcggcaccgagctgtaccgcaaggaactgcccgccgcgtaa

DBGET integrated database retrieval system