KEGG   Stackebrandtia nassauensis: Snas_6148Help
Entry
Snas_6148         CDS       T01194                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sna  Stackebrandtia nassauensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sna00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Snas_6148
DNA repair and recombination proteins [BR:sna03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Snas_6148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6506804..6507403
Genome map
AA seq 199 aa AA seqDB search
MYEGALGDLVDELGRLPGIGPKSAQRIAFHILGTDKADVDRLAEALRVVKERVRFCEICG
NVATEEKCRICRDARRTDEMICVVEEPKDVIAIERTGEFRGRYHVLGGAINPLDGVGPED
LRIRELMTRLQAGVTKELVIATDPNTEGEATATYLALMITPMGLTVSRLASGLPVGGDLE
YADEVTLGRAFEGRRTVQQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaggagcattgggcgacctggtcgacgaactgggtcgtctaccggggatcggg
ccgaagagcgcgcagcggatcgccttccacatcctgggcaccgacaaggccgacgtggac
cggctcgccgaggcactgcgggtggtcaaggagcgggtgcggttctgcgagatctgcggc
aacgtcgccaccgaggagaagtgccgcatctgccgggacgcgcgtcgcaccgacgagatg
atctgtgtcgtcgaggaacccaaggacgtcatcgccatcgagcgcaccggtgagttccgg
gggcgctatcacgtactgggcggggccatcaacccgctggacggggtgggaccggaggac
ctgcggatccgggagctcatgacccggttgcaggccggggtcaccaaggaactcgtcatc
gccaccgaccccaacaccgagggtgaggcgacggcgacgtacctggcgctcatgatcacg
ccgatggggctgacggtgtcgcgactggcgtcgggactgcccgtcgggggcgatctggag
tacgccgacgaggtcacgctgggccgcgcgttcgaggggcgtcgtaccgtccaacagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system