KEGG   Stackebrandtia nassauensis: Snas_6210Help
Entry
Snas_6210         CDS       T01194                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sna  Stackebrandtia nassauensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Snas_6210
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_6210
   00052 Galactose metabolism
    Snas_6210
   00500 Starch and sucrose metabolism
    Snas_6210
   00520 Amino sugar and nucleotide sugar metabolism
    Snas_6210
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Snas_6210
   00524 Butirosin and neomycin biosynthesis
    Snas_6210
Enzymes [BR:sna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Snas_6210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6562307..6563215)
Genome map
AA seq 302 aa AA seqDB search
MSDVVVALDVGGTSMKCALVDVNGRVLHSETRVTPREHGPEAVIKSIVDTAVELAATPGY
RARAVGLVVPGPVDNERGIAVYSSNLGWRDVPFRQLVEAELGLPTALGHDVRAGGLAEAR
LGAGRGSRQLLFVAIGTGIAGAHIIDGSGLSGAHGAACELGHVVVRPDGPKCGCGQYGCV
ESLASAVQFERRYAEASGTAREAMDIIAAVDTDPIAQRVWRETIEVLADGFLLGIALLDP
DTIVVGGGLAKSGDALLTPLRTALTARATFHTVPRLVAAELGREAGCVGAALLGLERLED
GT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgacgtcgtcgtcgccctcgatgtcggcggcacctccatgaaatgcgccctggtc
gacgtcaacggccgggtcctgcacagcgaaacccgcgtcacgccacgggaacacggcccc
gaggccgtcatcaaatccatagtagacaccgcggtcgagctggccgccacccccggctac
cgggcccgcgccgtcgggctcgtcgtgcccggcccggtcgacaacgagcgcggcatcgcc
gtgtactcctccaatctcggctggcgcgacgtcccgttccggcagctggtggaggccgaa
ctggggctgccgaccgcgttgggtcacgacgtgcgcgccggtggcctggccgaggcccgg
ctgggtgctggacgcggcagccgccagctgctgttcgtcgccatcggcaccggcatcgcc
ggggcccacatcatcgacggttccggcctgtcgggcgcgcacggcgccgcctgcgaactg
ggccacgtggtggtgcgtcccgacggccccaagtgcggctgcggccagtacggctgcgtg
gagtcgctggccagcgccgtgcagttcgagcgccgctacgccgaggcgtccggcaccgcg
cgtgaggcgatggacatcatcgccgccgtcgacaccgacccgatcgcgcaacgggtgtgg
cgcgagacgatagaggtgctggccgacggtttcctgctgggcatcgcgctgttggacccc
gacacgatcgtcgtcggcggcgggctggccaaatccggcgacgcgctgctgacgccgctg
cgcacggccttgacggctcgcgctacttttcacaccgtgccaaggctggtcgcggccgaa
ctcggtcgcgaggcaggatgcgttggcgcggcactgctgggactggaacgactggaggac
ggcacgtga

DBGET integrated database retrieval system