KEGG   Stackebrandtia nassauensis: Snas_6321Help
Entry
Snas_6321         CDS       T01194                                 

Definition
(RefSeq) nucleotidyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sna  Stackebrandtia nassauensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Snas_6321
   00052 Galactose metabolism
    Snas_6321
   00500 Starch and sucrose metabolism
    Snas_6321
   00520 Amino sugar and nucleotide sugar metabolism
    Snas_6321
Enzymes [BR:sna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Snas_6321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6666987..6667883)
Genome map
AA seq 298 aa AA seqDB search
MPASNNESPAFKAVIPAAGFATRFLPATKAVPKELFPVIDKPVLQHVVEEAVAADVRDVI
LITGRGKTSMVDHFDRRPDLEQRLVEKGDTTRLASIIEASDLVDIFTCRQSEPLGLGHAV
SYAESHVGEEPFAVLLADEFTAPTDRLLPRMFEKQKETGGIVLALKEMPREEIHRYGVAA
IEERGDSDVVTVTGLVEKPDPAEAPSNLILIGRYVLPSAIFDAIRKTKPGRGGEIQLTDA
MELLLKDGMPVHGIVFTGTRHDTGEPEGYLRTIVELAWQREDLTTFKEWLSDFMAKQG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccagccagcaacaatgaatcccccgccttcaaagccgtcatccccgccgcgggcttc
gccacgaggttcctgcccgcgaccaaggcggtgccgaaggaactcttccccgtcatcgac
aaacccgtcctgcagcacgtcgtggaggaggccgtcgccgccgacgtccgcgacgtcatc
ctcatcaccggacgcggcaaaacctccatggtggaccatttcgaccgccgccccgacctc
gaacagcgactcgtcgagaagggcgacaccacccggctcgcctcgatcatcgaggccagc
gacctcgtcgacatcttcacctgccgccagtccgaacccctgggcctgggacacgccgtg
tcctacgccgaatcccacgtcggtgaggaaccgttcgcggtcctgctcgccgacgagttc
accgcccccaccgaccggctgctgccgcgcatgttcgagaagcagaaggagaccggcggc
atcgtcctggcgctgaaggagatgccgcgcgaggagatccaccgctacggtgtggccgcc
atcgaggaacgcggtgactccgacgtcgtcaccgtcaccggactggtggaaaagccggac
cccgccgaggcgccgagtaatcttatcctcatcggacgatacgtccttccatcggctatc
ttcgatgcgattcgaaaaaccaaacccggacgaggtggcgaaatacagctcaccgacgcc
atggaactgttgctcaaggacgggatgcccgtgcacgggatcgtattcaccggcacccgg
catgacactggggaaccggaaggctacctgcgcaccatcgtcgaactggcctggcagcgc
gaggatctgacgacgttcaaggaatggctgtcggacttcatggcgaagcaaggctga

DBGET integrated database retrieval system