KEGG   Stackebrandtia nassauensis: Snas_6321Help
Entry
Snas_6321         CDS       T01194                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sna  Stackebrandtia nassauensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Snas_6321
   00052 Galactose metabolism
    Snas_6321
   00500 Starch and sucrose metabolism
    Snas_6321
   00520 Amino sugar and nucleotide sugar metabolism
    Snas_6321
Enzymes [BR:sna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Snas_6321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6666987..6667883)
Genome map
AA seq 298 aa AA seqDB search
MPASNNESPAFKAVIPAAGFATRFLPATKAVPKELFPVIDKPVLQHVVEEAVAADVRDVI
LITGRGKTSMVDHFDRRPDLEQRLVEKGDTTRLASIIEASDLVDIFTCRQSEPLGLGHAV
SYAESHVGEEPFAVLLADEFTAPTDRLLPRMFEKQKETGGIVLALKEMPREEIHRYGVAA
IEERGDSDVVTVTGLVEKPDPAEAPSNLILIGRYVLPSAIFDAIRKTKPGRGGEIQLTDA
MELLLKDGMPVHGIVFTGTRHDTGEPEGYLRTIVELAWQREDLTTFKEWLSDFMAKQG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccagccagcaacaatgaatcccccgccttcaaagccgtcatccccgccgcgggcttc
gccacgaggttcctgcccgcgaccaaggcggtgccgaaggaactcttccccgtcatcgac
aaacccgtcctgcagcacgtcgtggaggaggccgtcgccgccgacgtccgcgacgtcatc
ctcatcaccggacgcggcaaaacctccatggtggaccatttcgaccgccgccccgacctc
gaacagcgactcgtcgagaagggcgacaccacccggctcgcctcgatcatcgaggccagc
gacctcgtcgacatcttcacctgccgccagtccgaacccctgggcctgggacacgccgtg
tcctacgccgaatcccacgtcggtgaggaaccgttcgcggtcctgctcgccgacgagttc
accgcccccaccgaccggctgctgccgcgcatgttcgagaagcagaaggagaccggcggc
atcgtcctggcgctgaaggagatgccgcgcgaggagatccaccgctacggtgtggccgcc
atcgaggaacgcggtgactccgacgtcgtcaccgtcaccggactggtggaaaagccggac
cccgccgaggcgccgagtaatcttatcctcatcggacgatacgtccttccatcggctatc
ttcgatgcgattcgaaaaaccaaacccggacgaggtggcgaaatacagctcaccgacgcc
atggaactgttgctcaaggacgggatgcccgtgcacgggatcgtattcaccggcacccgg
catgacactggggaaccggaaggctacctgcgcaccatcgtcgaactggcctggcagcgc
gaggatctgacgacgttcaaggaatggctgtcggacttcatggcgaagcaaggctga

DBGET integrated database retrieval system