KEGG   Streptococcus pneumoniae 670-6B: SP670_0137Help
Entry
SP670_0137        CDS       T01308                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SP670_0137
Enzymes [BR:snb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SP670_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
118364..120151
Genome map
AA seq 595 aa AA seqDB search
MTRFEIRDDFYLDGKSFKILSGAIHYFRVPPEDWYHSLYNLKALGFNTVETYVAWNLHEP
REGEFHFDGDLDLEKFLQIAQDLGLYAIVRPSPFICAEWEFGGLPAWLLTKNMRIRSSDP
AYIEAVGRYYDQLLPRLVPRLLDNGGNILMMQVENEYGSYGEDKAYLRAIRQLMEECGVT
CPLFTSDGPWRATLKAGTLIEEDLFVTGNFGSKAPYNFSQMQEFFDEHGKKWPLMCMEFW
DGWFNRWKEPIITRNPKELADAVREVLEQGSINLYMFHGGTNFGFMNGCSARGTLDLPQV
TSYDYDALLDEEGNPTAKYLAVKKMMATHFSEYPQLEPLYKESMELDAIPLVEKVSLFET
LDSLSSPVESLYPQKMEELGQSYGYLLYRTETNWDAEEERLRIIDGRDRAQLYVDGQWVK
TQYQTEIGEDIFYQGKKKGLSRLDILIENMGRVNYGHKFLADTQRKGIRTGVCKDLHFLL
NWKHYPLPLDNPEKIDFSKGWTQGQPAFYAYDFTVEEPKDTYLDLSEFGKGVAFVNGQNL
GRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGQYKEEIHLTRKPTLKHIKGENL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgacacgatttgagatacgagatgatttctatctcgatggaaaatcatttaagatttta
tctggtgccattcattattttagggttcctccagaggattggtatcattcgctctataac
ttgaaggctcttggttttaatacggtagagacttatgttgcttggaatttacacgagcct
cgtgaaggtgagtttcattttgacggtgatctggatttagagaaatttctccaaatagcg
caggatttgggtctctacgcaattgtgcgtccgtctccatttatctgtgcggaatgggaa
ttcggtggcttaccagcttggctcttgaccaagaacatgcgaattcgctcatccgaccca
gcatatatcgaggcagttggtcgctactatgatcagttattgccaagactggtgcctcgt
ttgttggacaatggtggcaatattctcatgatgcaggttgaaaatgagtatggttcttac
ggagaagataaggcttacctgagagcgattcgacagctaatggaagagtgtggcgtaacc
tgtcccctctttacatcagatggtccatggcgagctactctgaaagctggaaccttaatt
gaagaggacctctttgtaacaggaaactttggttctaaggcaccttacaacttttcgcag
atgcaggaattctttgatgaacatggtaagaaatggccactcatgtgtatggagttctgg
gatggttggttcaatcgctggaaagaaccgattatcacacggaatcctaaggaattggca
gatgcagttcgagaggttttggaacaaggctctatcaatctttacatgttccacggtggt
acaaactttggtttcatgaatggttgctcagctcgaggaactttggacctgccacaagtt
acgtcttatgattacgatgcccttctggatgaagaaggaaatccaactgctaaatatctt
gcagtcaagaagatgatggcaacacatttttcagagtatccgcagttggaaccactctac
aaagagagtatggagttggatgctattccactagttgaaaaagtttctttatttgaaacc
ttagatagcttgtcaagtcctgtagaaagtctctatcctcaaaagatggaggagctggga
caaagttatggctacctactttatcgaacagaaacaaactgggatgcagaagaagaaaga
cttcgtatcattgatggtcgagatagggcccagctgtatgtcgatggtcagtgggttaaa
actcaatatcagacagagattggggaagatattttttatcaaggtaaaaagaaagggcta
tctaggttagatatcttgatagaaaatatggggcgtgtcaactatgggcataagttctta
gcggatacgcaacgtaagggaattcggacaggggtctgtaaggatctgcatttcttacta
aactggaaacactatccactcccactagacaatcctgagaaaattgatttttcaaaagga
tggactcaaggacaaccagccttttacgcttatgactttacagtcgaagagccaaaagat
acttacctagacttgtctgagtttggtaagggggttgcctttgtcaatgggcagaatcta
ggacgtttttggaacgttggcccaactctctcactttatatccctcatagctatctcaag
gaaggtgccaaccgcatcattatctttgaaacagaaggtcaatataaagaagagattcat
ttaactcgtaaacctacactaaaacatataaagggggaaaacttatga

DBGET integrated database retrieval system