KEGG   Streptococcus pneumoniae 670-6B: SP670_0230Help
Entry
SP670_0230        CDS       T01308                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SP670_0230
  Amino acid metabolism
   00300 Lysine biosynthesis
    SP670_0230
Enzymes [BR:snb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SP670_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
203013..204386
Genome map
AA seq 457 aa AA seqDB search
MVFPSEQEQIEKFEKDHVVQHYFEVLRTLISKKSVFAQQVGLKEVANYLGEIFKRVGAEV
EIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTEDPFTLSVRNGFMYGRG
VDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTDLDKYLEKHADKLRGADL
LVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYGGVVESAPWYLLQALQSLR
AADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIYGLELPLLQEERMAFLKRFF
FDPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLEPHDVLEKIRKQLDKNGFDKV
ELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLPTTAGTGPMHTVFDALEVPMVA
FGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtttttcctagcgaacaagaacagattgaaaaatttgaaaaggatcatgtagtccaa
cattattttgaggttttgcgtaccttgatttctaagaaatcagtctttgcccagcaggtt
ggactcaaggaagtcgcaaattatctgggtgagattttcaagcgtgttggagctgaagtg
gagattgatgagagctatacagcgccctttgtcatggcacatttcaagagttcgcgtcca
gatgccaagaccttgattttctataaccactatgacactgtgccagcggatggggatcag
gtctggacagaggatccttttacgctttcggtccgcaatggcttcatgtatgggcgtggg
gttgatgacgacaagggtcatatcacagctcgcttgagtgctttgagaaaatatatgcag
caccatgatgatttacctgtcaatatcagctttatcatggagggagcggaggaatcggct
tcaacagacctagataagtatttggaaaagcatgcagacaaactccgtggggcggatttg
ttggtctgggaacaagggaccaaaaatgccttggaacagctggaaatttctggtggcaat
aaggggattgtgacctttgatgccaaggtaaaaagcgctgatgtggatatccactcgagt
tatggtggtgttgtggaatcagctccttggtatctcctccaagccttacagtctcttcgt
gctgcggatggccgtatcttggttgaaggcttgtacgaagaagtacaagagcccaatgaa
cgagaaatggccttgctagaaacttatggtcaacgaaacccagaggaagttagtcggatt
tatggattggagttgcctctcttacaggaggagcggatggcctttctaaaacgtttcttt
ttcgatccagcgcttaatatcgaaggaatccagtctggttatcaaggtcagggtgttaag
actattttacctgcagaagccagtgccaagctagaggttcgtctggttccgggcctagaa
ccgcatgatgttctggaaaaaattcggaaacaactagacaaaaatggctttgataaggta
gaattatactataccttgggagagatgagctatcgaagcgatatgagcgcaccagccatt
ctcaatgtgatcgagttggccaagaaattctatccacagggcgtttcagtcttgccgacg
acagcggggacaggacctatgcatacggtctttgatgccctagaggtaccaatggttgca
ttcggtctaggaaatgccaatagccgagaccacggtggagatgaaaatgtgcgaatcgct
gattattacacccatatcgaattagtagaggagctgattagaagctatgagtag

DBGET integrated database retrieval system