KEGG   Streptococcus pneumoniae 670-6B: SP670_0357Help
Entry
SP670_0357        CDS       T01308                                 

Definition
(GenBank) alcohol dehydrogenase, propanol-preferring
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
snb00010  Glycolysis / Gluconeogenesis
snb00625  Chloroalkane and chloroalkene degradation
snb00626  Naphthalene degradation
snb01100  Metabolic pathways
snb01110  Biosynthesis of secondary metabolites
snb01120  Microbial metabolism in diverse environments
snb01130  Biosynthesis of antibiotics
snb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SP670_0357
  Lipid metabolism
   00071 Fatty acid degradation
    SP670_0357
  Amino acid metabolism
   00350 Tyrosine metabolism
    SP670_0357
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SP670_0357
   00626 Naphthalene degradation
    SP670_0357
Enzymes [BR:snb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SP670_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 Sacchrp_dh_NADP Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ADM90432
Position
complement(318172..319191)
Genome map
AA seq 339 aa AA seqDB search
MKAVVVNPESTGVAVEEKVLRPLETGEALVEIEYCGVCHTDLHVAHGDFGQVPGRVLGHE
GIGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKVEPGQWVVLYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVEDVAGLIKEKTDGGAHSAVVTAV
SKVAFNQAVDSIRAGGRVVAVGLPSEMMELSIVKTVLDGIQVIGSLVGTRKDLEEAFQFG
AEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttgttgtaaatccagaaagcactggtgttgctgttgaagaaaaagtactc
cgcccacttgaaactggggaagcacttgtagaaattgaatactgtggtgtttgccacact
gacctccacgttgcccatggcgacttcggtcaggtaccaggacgtgtcctaggtcacgaa
ggtatcggtatcgttaaagagattgctccagatgtgaaaagccttaaagtcggtgaccgc
gtcagcgttgcttggttctttgaaggatgtggcacttgcgaatactgtacaactggtcgc
gaaaccctttgccgtacagtgaaaaatgctggctactcagtagacggtggtatggctgaa
caatgtatcgtaactgctgactatgctgtcaaagttcctgacggacttgatccagcccaa
gcttcttctatcacatgtgctggagtaacaacctataaagctatcaaagaagcaaaagtt
gaaccaggccaatgggttgttctttacggtgctggtggacttggtaacctcgctgttcaa
tacgctaaaaaagtattcaatgctcatgttatcgcagtcgatatcaacaatgacaaactt
gcccttgcaaaagaagtaggcgctgacattgtgattaacggcctcgaagttgaagatgta
gctggactcattaaagaaaaaactgatggaggagctcattcagctgtcgtaactgctgtg
tctaaagttgccttcaaccaggctgttgactccattcgtgctggtggtcgcgtcgtcgct
gttggtcttccttctgaaatgatggaactcagcatcgttaaaacagtcctcgatggaatc
caagtcatcggttctcttgtcggaactcgtaaagacttagaagaagccttccaatttggt
gcagaaggtctggtagtcccagttgttcaaaaacgtccagtagaagatgctgttgccatt
ttcgacgaaatggaaaaaggccaaatccaaggacgtatggtactcgacttcacccactaa

DBGET integrated database retrieval system