KEGG   Streptococcus pneumoniae 670-6B: SP670_0366Help
Entry
SP670_0366        CDS       T01308                                 

Definition
bifunctional folate synthesis protein (EC:2.7.6.3 4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SP670_0366
Enzymes [BR:snb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SP670_0366
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     SP670_0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
325827..326639
Genome map
AA seq 270 aa AA seqDB search
MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDLDLTASVHYGELCQQW
TTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPVHLSLDTCSVTIHRRKQ
RAFIALGSNMGDKQANLKQAIDKLRARGIYILKESSVLATEPWGGVEQDSFANQVVEVET
WLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLF
VLESLQEIAPHFIHPILKQPIRNLYDALKK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggatcaactgcagattaaggatttggaaatgtttgcctatcatggtctttttcctagt
gagaaagaattggggcagaaatttgtcgtttcagccatcctatcctatgatatgaccaag
gcagctacagacttggatttaacagcctctgtccattacggagaattgtgtcagcagtgg
acgacttggtttcaggaaacgagtgaagatttgattgaaacggtagcctataaactggtg
gaacgtacctttgagtcttatcctcttgtccaagaaatgaagttggaactgaaaaaacct
tgggcaccggtgcatttgtcactagatacttgctcggtaaccattcatcgccgcaagcaa
cgagcctttatcgccctaggaagcaatatgggagataaacaagcaaacttgaagcaagcc
attgacaaactgcgagctcgtggcatctatattctcaaagagtccagtgtcttagcgacg
gagccttggggtggagtggagcaggatagctttgccaatcaagtggttgaggtggaaacc
tggctaccagcacaagacttgttagaaaccttgttagccattgagtcagagctgggacgg
gtgagagaagtgcattggggacctcgtttgattgatttggacttgctctttgtggaggac
cagatcctttatacagacgacctcatattgcctcatccttacatagcggaacgccttttt
gtccttgagtccttacaggaaattgcgcctcattttatccatccgatattaaaacaaccg
atccgtaacttgtatgatgctttgaaaaaatag

DBGET integrated database retrieval system