KEGG   Streptococcus pneumoniae 670-6B: SP670_0473Help
Entry
SP670_0473        CDS       T01308                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:snb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(430513..432879)
Genome map
AA seq 788 aa AA seqDB search
MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTGTMADVIEGEDYTFWG
QIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHFKGIGLKTAQKIVDTYGENTIDEIL
QHPEKLEGITGLSAKNREAFVSTLRLNYGTEMVLSKLANYGIPNKLAFQIQDFYKEETLD
VVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGLVHSLFQACMETGDTYVEA
RDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQIDTKIFDNSLFFAEEGIRSHL
IRILEKGKQKSHDLETIQKHITTIEEELGIEYDNIQKQAICDAIQNKVFILTGGPGTGKT
TVINGIIAVYALLEGLDLRKKSNLPILLAAPTGRAARRMNELTGLPSATIHRHLGMTGDD
DTSHLEDYLDADFIIVDEFSMVDTWLANQLFSNISSNSKILIVGDSDQLPSVSPGQVLAD
LLHIPLIPQTRLEKIYRQSEESTIVTLASQIRQGILPADFTKKKADRSYFEIASGHIPAT
IEKILGAALRNGIPARDIQVLAPMYRGTAGIDAINQLMQDLLNPPQKDQLSFEAPQCHYR
KRDKVIHLVNDAEINVFNGDLGAITDLIPGKYTESKQDEIVIDFDGNEVSYPRNEWYKIR
LAYAMSIHKSQGSEFPVVILPITSASRRMLERNLIYTAITRAKSKLILLGELQAFDYATQ
HIGTARKTYLIERFSDLLENVEEKQQAVSETVTSSASEQSYILTEENWDSIPAMIGITDT
DLKEIFGK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttatttttcaggaaccattgaacggattatttttgaaaatcccagcaatttt
tatcgcatcctcctcctagaaatcgacgatacggacgcagaggattttgatgattttgaa
atcattgtcacaggaaccatggctgatgtaattgagggcgaagactatactttttggggg
caaattgtccagcactccaagtatggagaacaactgcaaatcagtcgttatgatcgcgca
aaaccaactagtaagggcttggtcaagtacttttcaagtagccatttcaaggggattggt
ctcaagacagctcagaaaatcgtggatacctatggcgaaaataccattgacgaaattttg
caacacccagaaaagttagaaggcatcacaggactctctgccaaaaatcgcgaggctttc
gtctccactctccgtctcaactacggaacggagatggttttgtccaaactagccaactac
ggcattcccaacaaactagcctttcagattcaagacttttacaaggaagaaacccttgat
gtggttgaaaattatccctaccagctggttgaggatatcaagggtttgggctttaccatt
gctgaccaactagctgaggaactaggcatcgaaagtcaggctcctgaacgcttccgcgcc
ggtctagttcacagtctttttcaggcctgtatggaaacaggggacacctatgttgaagca
cgggatttgctggaacaaacccttactctccttgagtcttcccgtcccgtggaactagac
cccagccaagttgcccaagagctctcctacctgatcgaagaagacaaggttcagcagatt
gataccaagatctttgacaacagcctctttttcgctgaggaaggcatccgcagtcacttg
attcgtatccttgaaaaaggaaaacagaagagtcatgatttagaaaccattcaaaaacat
atcactactatcgaggaagagctgggaattgagtatgataacattcaaaaacaggctatc
tgtgatgctatccagaataaggtctttatcctgacaggtggacctggtactggtaagaca
actgttatcaatgggatcatcgctgtttacgccctgttagagggacttgacctcaggaag
aaaagcaacctgcccattcttcttgctgctccaactggtcgagctgctcgtcgcatgaat
gaattgacaggtttgcctagcgcgaccatacaccgccacttgggaatgacaggtgacgat
gataccagtcatctggaagattacctagatgctgactttatcatcgtggatgaattctct
atggtggatacttggctggccaatcaactcttctccaatatctcttctaacagtaagatc
ctcatcgtaggtgacagtgatcagctaccttctgtcagtcctggacaggttctagcggat
ctgcttcatattcctttgattcctcagactcgcttggaaaaaatttatcgacaaagcgaa
gaatcaaccatcgtcaccctagctagtcagattcgacagggcatcttgccagctgatttc
accaaaaaaaaagctgaccgttcctactttgaaattgctagtggccatattcctgccacc
attgaaaaaatcttaggtgccgccctcagaaatggtattcctgcccgtgatatccaagtt
ctggctcctatgtaccgagggacggcagggattgatgctatcaatcagctcatgcaagac
ctgctcaatcccccacaaaaagatcaactcagttttgaagctcctcagtgccactatcgt
aagagagacaaggtcattcatttggttaacgatgctgaaatcaatgtctttaatggggat
ttaggagctatcacagacctgattcctggtaaatacaccgaatcgaaacaagacgagatt
gtcattgattttgatggtaatgaagtctcttacccccgtaacgaatggtacaaaattcgc
ttggcctatgccatgagtattcataagtctcagggaagtgagttcccagttgtcatccta
ccgattactagtgctagccgacgtatgctggagcgaaatctcatctacacagccattaca
cgtgccaaaagcaaactcatcttactaggcgaattacaagccttcgactatgctacccaa
cacatcggaactgcccgaaaaacctatctgattgaacgcttcagtgatctactggagaat
gttgaagaaaagcaacaagctgtctctgaaacagtcacatcaagtgcctctgaacaatcc
tacatcctaaccgaagaaaactgggacagcattccagccatgattgggattacagacaca
gacctcaaagagatttttggaaaatag

DBGET integrated database retrieval system