KEGG   Streptococcus pneumoniae 670-6B: SP670_0785Help
Entry
SP670_0785        CDS       T01308                                 

Definition
6-phospho-beta-glucosidase AscB (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:snb00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
739725..740021
Genome map
AA seq 98 aa AA seqDB search
MDTPDENGYVADDYRITYLEAHIKAMRDAIYQDGVDLLGYTTWGCIDPVSAGTGEMNKRY
GFIYVDRDNVGNGALKRSKKKSFYWYKDVIDSNGASIG
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggatacaccggatgagaatggttatgtagcagatgactatcggattacttacttagag
gcccacatcaaggccatgcgagatgccatttaccaagacggggttgacttgcttggttat
acgacttggggctgtatcgatccggtttcagctggcacaggggaaatgaataagcgctat
ggctttatctatgtagatcgagataatgtaggaaacggagctctcaaacgtagcaagaag
aagtccttctattggtacaaggatgtcattgatagcaatggtgcaagcatcgggtag

DBGET integrated database retrieval system